KEGG   Sulfurisphaera tokodaii: STK_12000
Entry
STK_12000         CDS       T00062                                 
Symbol
sufB
Name
(GenBank) Fe-S cluster assembly protein SufB
  KO
K09014  Fe-S cluster assembly protein SufB
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STK_12000 (sufB)
SSDB
Motif
Pfam: SUFBD SufBD_N
Other DBs
NCBI-ProteinID: BAB66241
UniProt: Q972C8
Position
complement(1202953..1204392)
AA seq 479 aa
MPEEKFSLDINEIINATIEAKNNNLSQSEFHKRVVESGLSKDVIVEISKLKKEPEWMLRL
RLKSLELFEKLPTPNWLPDFLSELDVSKMEIYIKPDVERTSNWDEVPPEIRKYYEQLGIP
QSEQQYLGGLVATFESESIYSNVKQELAKKGVIMMPPEEAIQKYPDIIKEYFTKIFPVSD
HKFAALHGALWSGGVFVYVPKGVKITTPVEGFFIIGSEMEGQFEHTLIIADEGSYIHFIE
GCSAPQFKKFSFHDGMVELYAKKNAYIKFTTVQNWSKNVINFNNKRAWADENSTVEWVEG
SLGSKYSFVYPSTILRGRNASSTSLVVTLASGEGEWKDSGSKMIHAAPNTKSKVINKNIG
FNGGVNIYRGLIRVNKGATGAKAFVKCDSLMLDEKTKAYTFPHNQVFEEDADVAHEAHTF
RMNEDQLFYLMNRGIDEKESVSMLVLGFIDEIMKELPFEYATMLNKVIKLELDKLGAVA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgccagaagagaaattctcgcttgatattaacgagatcataaatgccacaatagaggct
aaaaacaataatcttagtcaaagtgaatttcataaacgtgtagtagagtcagggctaagc
aaagacgtaatcgttgaaatttcaaaactcaaaaaagaaccagaatggatgctcagatta
agattaaaaagtttagaattatttgaaaaactcccaactcctaattggttaccagatttc
ctttccgaattagatgtttcaaaaatggaaatttacataaagcctgatgtagaaagaaca
tcaaattgggatgaagtaccaccagaaattagaaaatattatgaacaattaggaattcct
cagtcagaacaacaatacttaggaggtttagttgcaacatttgaatcagaatcaatttac
tctaacgttaaacaagaattagctaagaaaggagtaataatgatgccgccagaagaagca
atacaaaaatacccagacataataaaagaatacttcacaaaaatcttccccgtttccgat
cacaaatttgccgcacttcatggtgccttatggagtggtggagtattcgtatatgtacca
aaaggtgtgaaaataaccacaccagtcgaaggattcttcataataggaagtgaaatggaa
ggacaatttgagcacaccttaatcatagcagatgaaggttcatatatacatttcattgaa
ggatgctcagcaccacaatttaagaaattctcattccacgatggtatggtagaattatat
gcaaagaaaaacgcttatattaaattcacaacagtacaaaactggagcaaaaatgtaatt
aactttaataataagagggcatgggcagatgaaaattcaacagtggaatgggtagaaggt
tctttaggatcaaaatatagtttcgtttatccatcaacaatattaagaggaagaaatgcc
tcatcaacaagtttagtagtaacattagccagcggtgaaggagaatggaaggacagcgga
tcaaaaatgattcacgcagcaccaaatactaagagtaaagtaataaacaagaacatagga
tttaatggcggagtaaacatatacagaggcttaataagggttaacaaaggagctactggt
gcaaaagcatttgtaaagtgtgattcactaatgcttgatgagaaaacaaaagcatataca
ttcccacataaccaagtctttgaagaagatgcagatgtagctcatgaagcccatactttc
agaatgaatgaagatcaattattctatttaatgaatagaggtatagacgaaaaagaatca
gtttcaatgctagtcttaggatttattgatgagattatgaaagaactaccatttgaatat
gctacaatgctgaataaggttattaagttagaattagataaactaggtgcagtggcataa

DBGET integrated database retrieval system