KEGG   Sulfurisphaera tokodaii: STK_12010
Entry
STK_12010         CDS       T00062                                 
Symbol
sufC
Name
(GenBank) Fe-S cluster assembly ATPase SufC
  KO
K09013  Fe-S cluster assembly ATP-binding protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sto02000]
    STK_12010 (sufC)
Transporters [BR:sto02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    STK_12010 (sufC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N DUF1439 AAA_13 AAA_29 AAA_15 AAA AAA_23 AAA_25 AAA_27 RsgA_GTPase
Other DBs
NCBI-ProteinID: BAK54480
UniProt: F9VNX2
Position
complement(1204483..1205220)
AA seq 245 aa
MTTLKIENLHVTVEGKEILKGVSLTINSGEIHVLMGPNGSGKTSLSLAIMGHPKYKITEG
KILLDNEDITNLETHEKVKKGLFLAFQNPIEISGVKLSTLLVAEYNRIYGSSQSPLQVIS
YVKELSKTVGVSDSLLNRGVFEGFSGGEKKRTEILQMLLMKPKIAILDEPDSGVDVDGLR
AIAEAIVKLRNENNTGYLIITHYRRILDHVKADKVHVLYRGKIVASGGMELAKLIDEKGY
EGILK
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacaactttaaaaatcgaaaatcttcacgtaacagtagaaggtaaagaaatactcaaa
ggtgtctcgctaactataaactctggagagatacatgtattaatgggacctaacggaagt
ggaaagacctcattatcactggctataatgggacatcctaaatataaaatcactgaaggc
aaaatcttactagataatgaagatataacaaatcttgaaacacatgaaaaagtcaaaaaa
ggattattcttagcatttcaaaatcccatagaaataagcggagtaaaactttctacatta
ctagtagcggagtataacagaatttacggttcatcacaatccccgctacaagttataagt
tatgtaaaagaactaagtaaaactgtaggagtaagtgactcattattaaacagaggtgtt
tttgaaggatttagtggtggagaaaaaaagagaacagaaattctacaaatgttattaatg
aaacctaaaatagcaatactcgatgagccagattcaggtgttgatgttgacggtcttaga
gctattgctgaagctatagtaaaacttagaaatgagaataatactggatacttaataata
actcattatagaaggattcttgatcacgtgaaagctgataaagttcatgtactttataga
ggtaaaatagtagcttctggtgggatggaattagctaaacttatagatgaaaaagggtat
gaaggaatattgaaataa

DBGET integrated database retrieval system