KEGG   Sulfurisphaera tokodaii: STK_12400
Entry
STK_12400         CDS       T00062                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto00750  Vitamin B6 metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01230  Biosynthesis of amino acids
Module
sto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_12400 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STK_12400 (thrC)
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STK_12400 (thrC)
SSDB
Motif
Pfam: PALP HypA Prok-RING_1 A2L_zn_ribbon LysW-like_globular TF_Zn_Ribbon Zn-ribbon_8 YjdM_Zn_Ribbon DNA_RNApol_7kD zf-ribbon_3
Other DBs
NCBI-ProteinID: BAB66281
UniProt: Q971Y8
Position
1241780..1242967
AA seq 395 aa
MQGYLKCLDCGSEYPIQQDIITCPKCGGLLEIIVEPKKDFSFSKLKGKGVWRYRELIAGE
YKHIVSLNEGNTPLIASSTNKNLYFKFEGANPTGSFKDRGMTVAISSAKSLNYKVVVAAS
TGNTAASAAAYASRAGLRSYIVLPKGKVALGKLAQSILYGTTILEVDGSFDVAMNSVMKL
YRELKIVYPLNSFNPWRLEGQKTIAFEIVEDIGVPDNVIVPVGNAGNIYAIWKGFVELMN
IGVTDKVPRMIGIQAEGAAPIAKALEKGLDKPEFIDSPETVASAIRIGKPVNWKKAIKAI
KSSNGFATYVSDSEILEAQKELARREGIGAEPASAASYAGYLKLVNSGKIDKSEKTVLIL
TGHALKDPDAMIKAESRRILVNPEHINEIILSDLK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcaaggctatctaaaatgcttagactgtggatcagaatatcctatccaacaagatatt
ataacttgtcctaaatgtggaggattattagagataattgttgaacctaagaaagacttc
tcattcagtaaactaaaagggaaaggagtttggagatatagagaattaatagctggagaa
tacaaacatatagttagtttaaatgaaggaaataccccactaattgcttcttctactaat
aaaaatctatattttaagtttgaaggagccaaccctactggaagttttaaagatagagga
atgacagtagctataagttccgctaaatcattaaactataaagttgtagtagctgcatct
actggaaatactgcagcttcagccgctgcatatgcaagtagagctggtttaagaagttac
attgtattacctaaaggaaaagttgctttaggaaaattggctcaatctatactttatggg
actactatacttgaagttgatggcagttttgatgttgctatgaatagtgtaatgaaatta
tatagagaactaaaaatagtttatccgcttaactcttttaatccatggagacttgaagga
caaaaaactattgcttttgaaatagttgaggatattggagtacctgataatgtgatagta
cccgtaggtaatgccggaaacatttatgctatatggaagggatttgtagagttaatgaat
attggggttaccgataaagtacctagaatgattgggatacaagctgaaggagcagcgcca
atagctaaggctctagaaaaaggattagataaaccggaatttatagattcacctgaaact
gtagcctctgctataagaataggtaaaccagtgaactggaaaaaagcaattaaggctata
aaatcatctaatggatttgcaacttatgtttctgactctgagatcttagaggcgcaaaaa
gaattagctaggagagagggaataggtgcagaacctgcatcagctgcttcctatgctggt
tatttaaagcttgtaaattctggcaaaattgataaaagcgaaaaaactgttttaatttta
actgggcatgcgctaaaggacccagatgcgatgataaaagctgaatcacgaagaatttta
gttaacccagaacatataaatgaaataatcttgagtgatctaaaatga

DBGET integrated database retrieval system