KEGG   Sulfurisphaera tokodaii: STK_12410
Entry
STK_12410         CDS       T00062                                 
Symbol
lysC
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto00261  Monobactam biosynthesis
sto00270  Cysteine and methionine metabolism
sto00300  Lysine biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01210  2-Oxocarboxylic acid metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_12410 (lysC)
   00270 Cysteine and methionine metabolism
    STK_12410 (lysC)
   00300 Lysine biosynthesis
    STK_12410 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    STK_12410 (lysC)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     STK_12410 (lysC)
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-ProteinID: BAK54495
UniProt: F9VNY7
Position
1242964..1244307
AA seq 447 aa
MKVIKIGGSIQKDEKDYELILDKLKKEIDYNDKNIIVTSAIKNITNQLLDIIKNTDKAMD
IVTDIYDRHVRLLSKLTNGIEFERSFGEISKLADELFKIAWSVRVLDEVTPRVKDYILSF
GERFAVILLSAFLRSNNIQSSYILDPPLITDENFGEANVLLQQSKENLTKKIDGINGNVI
VIPGFIGKSTQNKFTTIGRGGSDYTATIVGKILGAKEVKLITEVPGIMTADPKKIPQAKT
IPRLALEEAIELSQLGAKKLHPRTFDPIFNTNLKVVIEGLYEEGSTVIEGNCTKDDILKG
IATRNNLELITIESTNIVGKIGSAATIMSEARNANVNLIAISQPVSETVIQLVIESQDKD
RLIERLNNLNNLIEDIQSRKVSAISIVGCGLRNKEISAKVINKASSLDPIFISRGLKGVS
LTFIVDEKDENSLAKELHEVILEWQTK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaaagtaattaaaataggtggatctattcaaaaagatgaaaaagactatgaattaata
ttagataaattaaagaaagaaattgattataatgataaaaacattattgtaacctcagca
attaagaacattacaaatcagctgttagatattataaaaaatacagataaagcgatggat
attgttactgatatttatgatagacatgtaagattactttctaagttaaccaatggaata
gagtttgagcgttcttttggagaaatttcaaaacttgctgatgagctttttaaaatcgca
tggtcagttagagtattagatgaggttactcctagggtaaaagattatatattatccttt
ggagaaagatttgcagtaattttactatccgcatttttaagatctaacaatatacagtct
agctatatattagatcctccccttataactgatgaaaattttggagaagctaatgtatta
cttcaacaatctaaagaaaatttaactaaaaaaatcgatggtattaatggaaatgttatc
gtaatcccaggatttattggcaaaagtacacaaaataaatttactacaataggacgtgga
ggaagtgactatactgcaacaatagtaggaaaaatactaggagcaaaagaggtcaagtta
ataactgaagtccctggaataatgactgctgatcctaagaaaataccacaagctaaaact
attccaagattagctcttgaggaagctattgaactttctcaacttggagctaaaaaatta
catccaagaacattcgaccctatatttaatacaaatctaaaagtagtaatcgaaggactt
tatgaggaaggcagtactgtaatagaaggaaactgtacaaaagatgacattttaaaagga
atcgccacaagaaataacctagaacttataacaatagaaagtactaatatagtaggaaaa
attggttctgccgctacaataatgtcagaagctagaaatgctaatgtaaaccttatcgca
atttctcaaccagtctcagaaacagtcattcaattagtaattgagtctcaagataaagat
agattaatagaaagactaaataatttaaataatttaatagaagatatacaatcaagaaaa
gtaagtgcaattagtatagttggttgcggattaagaaacaaggaaatttcggctaaagtc
attaataaggcttcatcactagaccctattttcatatctagaggtctgaaaggcgttagc
ttaacatttatagttgatgaaaaagatgaaaatagtttagccaaagaacttcatgaggtg
atcctggagtggcagacaaaataa

DBGET integrated database retrieval system