KEGG   Sulfurisphaera tokodaii: STK_12420
Entry
STK_12420         CDS       T00062                                 
Symbol
asd
Name
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto00261  Monobactam biosynthesis
sto00270  Cysteine and methionine metabolism
sto00300  Lysine biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01210  2-Oxocarboxylic acid metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_12420 (asd)
   00270 Cysteine and methionine metabolism
    STK_12420 (asd)
   00300 Lysine biosynthesis
    STK_12420 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    STK_12420 (asd)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     STK_12420 (asd)
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC DapB_N Gp_dh_C Ldh_1_N NAD_binding_3 Sacchrp_dh_NADP Epimerase GFO_IDH_MocA
Other DBs
NCBI-ProteinID: BAB66283
UniProt: Q971Y6
Structure
Position
1244292..1245344
AA seq 350 aa
MADKIKVSLLGSTGMVGQKMVKMLAKHPYLELVKVSASPSKIGKKYKDAVKWIEQGDIPE
EVQDLPIVSTNYEDHKDVDVVLSALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLI
NPEINWEHLELLKFQKERKGWKGILVKNPNCTAAIMSMPIKPLIEIATKSKIIITTLQAV
SGAGYNGISFMAIEGNIIPYIKGEEDKIAKELTKLNGKLENNQIIPANLDSTVTSIRVPT
RVGHMGVINIVTNERINIEEIKKTLKNFKSLPQQKNLPTAPKQPIIVRDEEDRPQPIIDV
NAESGMAVTVGRIRHENNVLRLVVLGDNLVRGAAGITILTVEVMKELGYI
NT seq 1053 nt   +upstreamnt  +downstreamnt
gtggcagacaaaataaaagtttcacttctaggctctactgggatggtaggacaaaaaatg
gtaaaaatgttagcaaagcatccctatttagagttagtaaaagttagtgcttccccttcg
aaaattggtaaaaaatataaagatgcagtaaagtggatagagcaaggagacataccagaa
gaagtacaagatttaccaatagtttcaacaaattatgaagatcataaagacgttgatgta
gtattgtcagctttaccaaatgaattagcagaatcaatagaacttgaacttgtgaaaaac
ggaaagatagttgtgtctaatgctagtccatttagaatggacccagatgtaccattaatt
aacccagaaattaattgggaacacctagaattacttaaatttcaaaaggaaagaaaaggt
tggaaaggtattctagtaaaaaatcctaattgtacagctgctataatgtcaatgccaata
aaacccttaattgaaatagcaacaaaatctaaaataataattactacactacaagcagta
agtggagctggatataatggaatatcatttatggcaatagagggtaatataatcccatac
attaaaggagaagaagacaaaatagcaaaagaactaactaaattaaacggaaaacttgaa
aataatcaaataattccagcaaacttagactcaactgttacatcaattagagtacctaca
agagtaggacatatgggagttattaatattgttacaaatgagagaatcaacatagaggaa
ataaagaaaacactaaagaattttaaatctttacctcaacagaaaaatttacctactgca
ccaaaacaaccaataatagtaagagatgaagaagatagaccacagccgattattgatgta
aatgcagaaagtggcatggcagtaactgtgggcagaataagacatgaaaataacgtgctt
aggttagtcgttttaggagataatttagttagaggagctgctggaataacaatacttact
gtagaagttatgaaagaattagggtacatttag

DBGET integrated database retrieval system