KEGG   Sulfurisphaera tokodaii: STK_12660
Entry
STK_12660         CDS       T00062                                 
Symbol
fib
Name
(GenBank) fibrillarin
  KO
K04795  fibrillarin-like pre-rRNA processing protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sto03009]
    STK_12660 (fib)
Ribosome biogenesis [BR:sto03009]
 Prokaryotic type
  Sno RNPs
   Box C/D snoRNPs
    STK_12660 (fib)
SSDB
Motif
Pfam: Fibrillarin PCMT GCD14
Other DBs
NCBI-ProteinID: BAK54501
UniProt: Q971W2
Position
1266646..1267347
AA seq 233 aa
MSELVKISKTQFENVFQCEFNDGTVRLCTKNLAPGFSVYGERLFKVEGVEYREWNAFRSK
LGGAILKGLKQNPIVKGTKVLYLGAASGTTPSHVSDIVELEGKVYGVEFSPRVVREFLLV
AQHRPNLFPILADARFPQYYRTLVEDVDVLYVDIAQPDETDIAIYNAKFFLKNGGYMMMA
IKARSIDVTKEPTEIYEMEVNKLKENNFDVIQVIQLDPYDKDHAMVLAKYKGK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtcagaattagttaagatttcaaaaacacagtttgaaaatgtgtttcaatgtgaattt
aatgatggcacagtaaggctttgtactaaaaacttagctccagggtttagtgtttatggc
gagaggctatttaaagtagaaggggtagagtatagagaatggaatgcttttagaagtaaa
ttaggcggtgctattctaaagggtttaaaacagaatcctattgtaaaaggaactaaagta
ctttatttgggtgcagcttctggaactactccaagtcatgtttctgatatcgtagaatta
gaaggaaaagtatacggagtggagttttctcctagagtagttagggaatttttacttgtc
gctcagcatagacctaatttatttccaattttagcagatgctagatttccgcaatattat
aggactcttgtagaagatgttgacgtattatatgtagatattgcccagccagatgaaaca
gatatagcaatctataatgctaaatttttccttaaaaatggtggatatatgatgatggca
ataaaagctagaagtattgatgttacaaaagaacctactgaaatctatgaaatggaagtt
aataagttaaaagaaaacaactttgatgttatccaagttattcagttagatccttatgat
aaagaccatgcaatggtgttagcaaaatataagggaaaataa

DBGET integrated database retrieval system