KEGG   Sulfurisphaera tokodaii: STK_12690
Entry
STK_12690         CDS       T00062                                 
Symbol
trm1
Name
(GenBank) tRNA (m2(2)G26) methyltransferase Trm1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_12690 (trm1)
Enzymes [BR:sto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     STK_12690 (trm1)
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     STK_12690 (trm1)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    STK_12690 (trm1)
SSDB
Motif
Pfam: TRM Met_10 OrfB_Zn_ribbon MTS
Other DBs
NCBI-ProteinID: BAK54503
UniProt: Q971V9
Position
1268622..1269746
AA seq 374 aa
MNLIEIREGKASLLIPNPKDYEKEGRYDPSWSPVFYNPKMRLNRDISVLALSVIKPKSVV
DALSASGVRGIRYYTEIGGIEKLILNDKNPIATELIKKNAEKNYVNARITTKDANSLLYE
IKADFVDIDPFGSPAPFILSAINATINKGYVAFTATDLSALECSSKFSARRKYDLICERL
SFSKELGIRGLIAKVIREGAIIEKAAYPIFSFYFDYYYRVFFRIENGAKKVDKLLEKQGY
YYECSKCGYREVDYYAERKICPRCGIEMRRYGPAWTGELWNREFLLSMKENLKNFTYFDT
FMQVNKLLNILVEESKYVSPYFRLDFIASLIKRNIPKREKMLECLKEASITHFDYRGIKT
NKEIDEIVNCIKIN
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaatttgattgaaataagagaaggtaaggcttctttactaattcctaatcctaaagat
tatgagaaagaagggagatatgatcccagttggtctccagttttctacaatcctaagatg
agattaaatagagatattagtgttttagccttaagtgtaataaagcctaaaagtgttgtc
gatgctctatctgcctctggagtcagagggataagatattatactgaaattggagggata
gaaaaattgatattaaatgataaaaatcctatagcaacagaattaataaagaaaaatgca
gagaagaactatgtgaatgctcgaataacaacaaaggacgcaaattctttattatatgag
attaaagcagattttgtagatatagatccttttggttctccagccccttttatcttgtca
gccataaacgctacaataaacaaaggctatgtagcttttactgcaactgatttatcagcc
ctagaatgttcttcaaaattttctgctagaagaaaatacgacttgatatgcgaaagatta
agtttttccaaagaattaggaattagaggtttaattgccaaggtaataagagaaggtgct
attatagaaaaagctgcatatcctatattttcattttattttgattattattatagagta
ttctttagaatagaaaatggcgctaaaaaagttgataaattacttgagaaacaagggtat
tattatgagtgttctaaatgtgggtatcgtgaggtcgattattatgcagaaagaaaaata
tgtcctagatgtggtatcgagatgagaagatatggtccagcatggacaggggaactatgg
aatagagagtttttgttaagtatgaaagagaatctaaagaatttcacatactttgatact
ttcatgcaagtaaataagttgttaaatatattagtagaagagtcaaagtatgtatcacct
tattttagactagattttatagcatccttaataaaaagaaatataccaaaaagagaaaaa
atgttagaatgtttaaaagaagcttcaataactcactttgattatagaggtataaaaact
aataaagaaatagatgaaatagtaaattgtataaaaattaactag

DBGET integrated database retrieval system