KEGG   Sulfurisphaera tokodaii: STK_12710
Entry
STK_12710         CDS       T00062                                 
Symbol
tfb2
Name
(GenBank) transcription initiation factor IIB 2
  KO
K03124  transcription initiation factor TFIIB
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    STK_12710 (tfb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_12710 (tfb2)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     STK_12710 (tfb2)
 Prokaryotic type
  Archaeal type
    TFB
     STK_12710 (tfb2)
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon OrfB_Zn_ribbon Sigma70_r4 zf-RRN7 Ribosomal_S27e HTH_11 Phage_terminase zf-ribbon_3 YjdM_Zn_Ribbon HTH_Tnp_ISL3 Zn_Tnp_IS1595 HTH_Mga Prim_Zn_Ribbon zf-FPG_IleRS zf-ACC RUBY_RBDX Lar_restr_allev GerE DZR DUF6398 HTH_AsnC-type Cyclin_C Nudix_N_2 C1_2 zf-TFIIB DUF2089
Other DBs
NCBI-ProteinID: BAB66313
UniProt: Q971V7
Position
complement(1270177..1271064)
AA seq 295 aa
MEKIKCPNCGSESITLDLNKGTYICTNCGYVIDEFVIDQGPEWRAYTEQDRLERERTGSP
ITAKVHDFGITTTIGYSRSSNKTKIEKLRAIQNKLRVSPKDRKLVTYLSVLNNEAAKLNL
PEYVKETASLLIRKIIDEGKAKRIDIYTLIAAVLYYSCQVNKIPKSLQEIKNNYGISSSE
LWKALERVQKVAKSSLEFKPNIKPTEFIPKIVEKLNLPPYISTKASELVDLMHKNGLTSG
KGYTALAAASVYLVSTLMDAKKTQKDIANALNITEVTIRNRYKEIISNFEIEVKL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagaaaataaagtgccctaattgcggaagtgaaagtataacgttagatctaaacaaa
ggcacatacatctgtactaattgtggatatgtcattgatgaatttgttatagatcaaggt
ccagaatggagagcgtatacagaacaagacagattggaaagagaaagaacaggttctcct
attactgcaaaagttcatgattttggaataacaacaacaattggatattctaggtccagt
aataaaactaaaatagaaaaattaagagcaatacagaataaactcagagtttctccaaag
gatagaaagttagtcacttatttatccgtattaaataatgaagctgctaagctaaatctt
cctgaatacgtaaaagaaacagcctctcttttaataagaaaaataatcgatgagggaaaa
gctaaaagaatagacatatatacgttaattgctgcggtactttactattcttgtcaagta
aataaaataccaaaatcccttcaagagataaagaataattatggtatttcatctagtgaa
ttatggaaagcactagagagagttcaaaaagtagctaagagttcattagagtttaaaccc
aatataaaacccacagagttcattccaaaaattgtagaaaaacttaatttaccaccatat
atatctactaaagcttctgaattagttgacttaatgcacaaaaatggtctaactagtgga
aaaggatacacagcattagcagctgctagtgtataccttgtaagtacactaatggatgca
aaaaagactcaaaaagacatagctaatgcactaaatataacagaagttacaataagaaat
agatataaggaaattatatcaaatttcgaaatagaagttaaactttaa

DBGET integrated database retrieval system