KEGG   Sulfurisphaera tokodaii: STK_12790
Entry
STK_12790         CDS       T00062                                 
Name
(GenBank) hypothetical protein
  KO
K14656  FAD synthetase [EC:2.7.7.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00740  Riboflavin metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    STK_12790
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthase
     STK_12790
SSDB
Motif
Pfam: CTP_transf_like DUF357
Other DBs
NCBI-ProteinID: BAB66320
UniProt: Q971V0
Position
1275870..1276556
AA seq 228 aa
MSNEIRNRVEKYIKGMEERLQKIPSHIYEKYRKVLDLAKQYTEDAKYYLSKEDEVTALVD
VVYAEGLLDSVIFNENLDIDSQISKKVFVGGTFDILHPGHIEFLKEASRYGRVYVSVARD
KNSEKVKGRKPINDENQRLEVVKSIRYVYEAFLGDEKDFLKSVERVKPDILFLGPDQHVD
ENKLKEELKKRGIDNIEIIRMKERINNWSHSSTTSIIQEIVKRYCNQR
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtctaatgaaataagaaatagagtagaaaaatatataaaagggatggaagaaagatta
caaaaaatacctagtcatatctatgaaaaatatcgtaaagtactagatcttgctaaacaa
tatacagaggatgcaaaatattatctgagtaaagaagatgaagttactgcgttggttgat
gtagtttatgctgaaggtttattagattcagttatatttaatgaaaatcttgatatagat
tcacaaatttctaaaaaagtattcgtaggtggcacatttgatatattacaccctggtcat
atagaatttttaaaagaggcttctcgttatggaagagtctatgtctctgttgcaagagat
aaaaactcagaaaaggtaaaagggagaaaaccaataaatgatgaaaatcaaagattagaa
gtagtaaagagcattagatatgtttatgaagcattcttaggagatgaaaaagattttcta
aaaagtgttgaaagggtaaaaccagacatattatttttaggtcctgatcagcatgttgat
gagaataaattaaaggaagagttaaagaaaagaggaattgataatatagaaataataaga
atgaaagaaagaataaataattggtctcattcaagcactacatcaataattcaagaaata
gtcaaaagatattgcaatcaaagataa

DBGET integrated database retrieval system