KEGG   Sulfurisphaera tokodaii: STK_12950
Entry
STK_12950         CDS       T00062                                 

Gene name
top6A
Definition
(GenBank) DNA topoisomerase VI subunit A
  KO
K03166  DNA topoisomerase VI subunit A [EC:5.6.2.2]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_12950 (top6A)
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     STK_12950 (top6A)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Topoisomerases
   STK_12950 (top6A)
SSDB
Motif
Pfam: TP6A_N DUF2812 DUF2399
Other DBs
NCBI-ProteinID: BAB66339
UniProt: Q971T1
Position
1295004..1296167
AA seq 387 aa
MSSELTSKVDKEARKKAADTLRQVFVKLIEQINNSEPPTMEIPKRTLGNTIYDEKRKLLL
LGEEKLKRSFFDLNESKRFMQTVLMASIIYDALINDEYPTIRDLYYRGKHSIILKDPRGK
TYEENTWDEQKESDSVIMDIEVFTSLLREDMLILSKEKGKVVGDMRIRSGNDIIDLSKMG
HGAYSIEPTPDLIDFVDINAEFVLVVEKDAVFQQLHRAGFWKQYKAILVTSAGQPDRATR
RFVRRLNEELKLPVYILTDADPYGWYIYSVFRIGSISLSYESERLATPNAKFLGVSMTDI
FGDSNKKPYLSEQERRNYIIKAKDADIKRATEIKNYQWFKTKAWQHEIEIFLNKKSKLEI
EAMASKGLKFLAFQYIPEKIKSKDYIE
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgagtagtgaattaacttctaaggtggataaagaagctaggaagaaggcagctgacact
cttaggcaagtttttgtaaaattaattgagcaaataaataactctgaacctccaactatg
gaaattccaaagagaactcttggcaatactatttatgatgaaaagagaaagctacttctt
ttaggcgaagagaaattaaagagaagtttcttcgatcttaatgagtctaaaagatttatg
caaacagtacttatggctagtataatatacgatgcacttattaacgatgaatacccaaca
atacgtgatctatattatagaggtaaacattctattatattaaaggatcctagaggtaaa
acttatgaagaaaatacatgggacgagcaaaaggagtcagatagtgtaataatggatatt
gaggtatttacgtctttgcttagggaagatatgcttattctaagtaaggagaaaggtaaa
gttgtcggtgatatgagaatcagaagtggaaacgacataattgatttaagcaaaatgggt
catggtgcatattctattgagccaaccccagatttaatagattttgtagatattaatgct
gaatttgtattagtagttgagaaagatgctgtatttcaacagcttcatagggcaggattc
tggaaacaatataaagccattttagttacaagtgcaggacagccagatagagcgacaaga
agattcgtaagaagactgaatgaagaactaaaattaccggtttatattttaaccgatgca
gatccatacggatggtatatttatagtgtttttagaataggatctatttcgttatcatac
gaaagtgaaagacttgctactcctaatgcgaagttccttggagtctcaatgactgatatt
tttggcgatagtaataagaaaccgtatctatcagagcaagaaagaagaaactatattata
aaagccaaagatgctgatataaaaagagctactgaaataaagaactatcaatggtttaag
actaaggcatggcaacatgaaatagagatctttcttaataaaaagtctaagttagaaata
gaagctatggcgagtaagggattaaaattcttagcgtttcaatacattccagagaaaatt
aaatcaaaagattatattgagtga

DBGET integrated database retrieval system