KEGG   Sulfurisphaera tokodaii: STK_13010
Entry
STK_13010         CDS       T00062                                 
Name
(GenBank) homocitrate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00290  Valine, leucine and isoleucine biosynthesis
sto00620  Pyruvate metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01210  2-Oxocarboxylic acid metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STK_13010
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    STK_13010
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     STK_13010
SSDB
Motif
Pfam: HMGL-like AsnC_trans_reg ACT_4 NapD Radical_SAM AP_endonuc_2 SurA_N_2 CinA_KH Glyco_hydro_97
Other DBs
NCBI-ProteinID: BAB66345
UniProt: Q971S5
Position
1301429..1302811
AA seq 460 aa
MKVGILDSTLREGEQTPGVVFTIDQRVEIAKALSDVGVQMIEAGHPAVSSDIYEGIKRIM
KLKREGLITSEIVGHSRAVKKDIEVAAELEVDRIAIFYGVSDIHLKAKHHVTREEALNII
AETISYAKSHGVKVRFTAEDGSRTDLDYLIKVCKTARDAGADRVSIADTVGILYPTKTRE
LFSTLVREVPGLEFDIHAHNDLGLAVANALAAIEGGATIIHTTVNGLGERVGIVPLQVIA
AAIKYHFGIEVVKLNKLQQLASLVEKYSGIPMPPNYPITGDYAFIHKAGIHVAGVLNDPS
TYEFMPPETFGRSRDYVIDKYTGKHALKDRFEKLGVKLSDVELDQVLAKIKSNPNVRFYR
DVDLLEIAESVTGRVLKPKPPENIEALISVKCESNVYTTAVTRRLSVIPGVKEVMEISGD
YDILVKVEAKDPNELNQIIENIRAVKGVSSTLTSLVLKKM
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaagtaggaatccttgactcaaccctaagagaaggagaacaaacacccggagttgta
ttcacaatagatcaaagagtcgaaatagcaaaagcattatcagatgttggtgttcagatg
atagaagcaggacatcctgcggtatcctcggatatttatgagggaataaaaaggattatg
aaacttaaaagagaaggacttattacatcagaaatagtagggcatagtagggctgtaaaa
aaagatatcgaagtagcagcagaattagaagtagatagaatagcaatattttatggtgta
agtgatatccaccttaaagcaaaacatcatgttacaagagaggaggcacttaatataata
gcagaaacaataagttatgcaaaaagtcatggtgttaaagtaagatttacagcagaagac
ggtagcagaaccgatttagattatttaataaaagtgtgtaaaacagcaagagatgctggt
gctgacagagtaagtatagccgatactgtgggtattctttatcccacaaaaacaagagaa
ttatttagtaccttagtaagggaagtaccaggtttagaatttgatattcatgctcataat
gatttaggtttagccgttgctaatgcgttggcagcaatagaaggcggagctactataatt
catactacagtaaatggattaggagaaagagtaggaattgttcctctccaagtaattgcg
gcagcaataaaatatcattttggaattgaagttgtaaagttaaataaattacaacaatta
gccagtctagttgaaaaatatagtggtataccgatgcctccaaactatccaataacagga
gattatgcatttattcataaagctggtattcatgtggctggagttcttaatgatccatca
acttacgagtttatgccaccagagacttttggaagaagtagagactacgttattgataaa
tatactggtaagcacgcactaaaagataggtttgaaaaattgggcgttaaattaagtgat
gtagaactagatcaagtactagctaaaataaaatccaatccaaatgttagattctataga
gatgtagacttattagaaatagctgagtcagttactggcagagtattaaaacctaaaccg
ccagaaaatattgaagctttaatttcagttaaatgtgagtcaaatgtttatactacagca
gtaactagaagattatctgttattccaggagtaaaagaagtcatggaaatctctggagat
tatgatattctcgttaaagttgaggcaaaagatcctaatgaacttaatcaaattattgaa
aatatcagagctgtaaagggtgtaagctctactttaacatcattagttcttaaaaagatg
taa

DBGET integrated database retrieval system