KEGG   Sulfurisphaera tokodaii: STK_13070
Entry
STK_13070         CDS       T00062                                 
Symbol
xpd
Name
(GenBank) DNA repair helicase XPD
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03022  Basal transcription factors
sto03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    STK_13070 (xpd)
  09124 Replication and repair
   03420 Nucleotide excision repair
    STK_13070 (xpd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_13070 (xpd)
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_13070 (xpd)
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     STK_13070 (xpd)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     STK_13070 (xpd)
DNA repair and recombination proteins [BR:sto03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     STK_13070 (xpd)
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 ResIII GvpD_P-loop TsaE AAA_16 AAA_19
Other DBs
NCBI-ProteinID: BAB66356
UniProt: Q971R4
Structure
Position
complement(1313692..1315314)
AA seq 540 aa
MEVLKLQLRQWQAEKLGEAINALKHGKTLLLNAKPGLGKTVFVEVLGMQLKKKVLIFTRT
HSQLDSIYKNAKLLGLKTGFLIGKSASCIYAQGDEEPDEINCSKCRLKDKIKTIEDKEPS
KLIEEFKDAVDYCPYYSLRANLKDKDVIAMTYPYLFQKPIRNSVFCNKDDCLKLEDYLIV
IDEAHNLLEADKWFTRKISRKMLERALKEIEIVERLNRIDAKKVKDYINLLIDYMSKLIK
DGRCHELSLMPLPDRETNGELIVVTRAYLNIDEGPVKKSSLKSLLKFVEMKGDLYNCNGS
LVKVPSDVNQLIEDALNVKTFKVLMSGTLPESLTLTNSYKIVVNESYGRGEYYYCPNVTS
ELRKRNSNIPIYSILLKRIYENSSKSVLVFFPSYEMLESVRIHLSGIPVIEENKKTRHEE
VLELMKTGKYLVMLVMRAKESEGVEFREKENLFESLVLAGLPYPNVSDDMVRKRIERLSK
LTGKDEDSIIHDLTAIVIKQTIGRAFRDPNDYVKIYLCDSRYREYFADLGISEKEIKLFA
NT seq 1623 nt   +upstreamnt  +downstreamnt
gtggaggtccttaaattgcagttaagacaatggcaggcggagaaattaggcgaagcaatt
aatgctttaaagcatggcaagactcttttgcttaacgcaaagcccggcttaggtaagacg
gtcttcgttgaagtattaggtatgcaactgaaaaagaaggttctgatatttaccagaaca
catagtcagttggacagcatttacaagaacgccaaacttttgggcttaaagacgggcttt
ctgataggtaagtcagcttcatgtatttacgctcagggtgatgaggaaccagatgaaata
aactgtagtaagtgcagactgaaggataaaataaagacaatagaggacaaagagccttca
aaactaatagaggagtttaaagatgctgtagattactgtccctattattcattaagggca
aaccttaaggataaggacgtaatagcgatgacttatccatatttatttcagaaaccgata
aggaattccgtcttctgtaataaggatgattgcttaaagcttgaggactatctgatcgta
atagacgaagcccataatttgcttgaagcggataagtggtttacgaggaaaataagtcgt
aaaatgttggagagagcgttaaaagagatagaaattgtcgaaaggcttaacagaatagat
gcgaagaaggtaaaagactacatcaacttgcttatcgattatatgagtaaactaatcaag
gacgggaggtgtcacgaattatcattaatgccattaccagatagggaaacaaacggcgag
ttaatagtagtaaccagagcgtatttaaatatagatgagggaccggtaaagaagtcaagt
ttgaagtcgttactaaagtttgttgagatgaaaggtgatctgtataactgcaacggaagt
ctggttaaagtaccttcagacgttaaccaattaattgaagacgcacttaacgttaagacg
tttaaagttttgatgagcggtactttacccgaatctttaacacttacaaattcgtacaag
attgtagtaaacgagagttacggaaggggagagtactattactgcccaaacgtaacttcg
gaactccgtaagaggaactccaacatccccatttactccatattgcttaagaggatttat
gaaaacagcagtaagagtgttcttgttttctttcccagctacgaaatgttagaaagtgtc
agaatccatctatcgggaattccggttattgaggagaataaaaagaccagacacgaagag
gttttagagctgatgaagaccggcaaatatctcgtaatgttggtaatgcgtgctaaagag
agtgagggagtggagtttagagaaaaggagaacctatttgaaagtttagtgcttgcagga
ttgccttatcctaacgtttcggatgatatggtaaggaagagaatagagaggctgagcaaa
ttaactggtaaagatgaggactcaataatacacgacttaactgcaatagtgattaagcag
actatcggcagggcttttagggatcctaacgattatgttaagatttacctttgtgattca
aggtatagggaatattttgctgacctgggtatttccgaaaaagagattaagctttttgca
tag

DBGET integrated database retrieval system