KEGG   Sulfurisphaera tokodaii: STK_13450
Entry
STK_13450         CDS       T00062                                 

Definition
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Other DBs
NCBI-ProteinID: BAB66408
UniProt: Q971L2
Position
1354020..1354328
AA seq 102 aa
MRAVALSMPLVIPKRRIYKKTKGNYTYYTIYIPQDFNDLIPIPAFITIIIGNETLKLGVR
RPFKVGREKYAIILSKELASIWERLIKESIEVTLVLEPISSQ
NT seq 309 nt   +upstreamnt  +downstreamnt
gtgagggcagtggctttatcgatgcccctggtgataccgaaacgtcggatatataagaag
actaagggaaactatacctattataccatttatatacctcaagatttcaatgatctaatc
cctattccagcttttataacaataataataggaaacgaaacattgaagttgggtgttaga
agacctttcaaagttggaagagagaaatatgcaattatcttatcaaaagaattagcgtct
atttgggaaagactaatcaaagaaagcatagaagtaacgttggtcttagagcctatctca
agtcagtaa

DBGET integrated database retrieval system