KEGG   Sulfurisphaera tokodaii: STK_13560
Entry
STK_13560         CDS       T00062                                 
Symbol
gap
Name
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) [EC:1.2.1.59]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00002  Glycolysis, core module involving three-carbon compounds
sto_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_13560 (gap)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     STK_13560 (gap)
SSDB
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA IlvN NAD_binding_3 Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: BAB66418
UniProt: Q971K2
Position
complement(1362819..1363850)
AA seq 343 aa
MEKVKVAVNGYGTIGKRVADAIRLQPDMELIGVGKTSPNYEAIIADKKGIKIYTVKDNIG
KFEKSGIRVAGTIEDMVKEADIVVDTTPNGVGATYKPLYQSLGKNALFQGGEKADVADIS
FSALCNYDEAKGKKYIRVVSCNTTGMLRIICTMNKISKVEKVRATIVRRAADPKEVKRGP
INSIVPDPASVPSHHAKDVLTVIKGIDIVTMAVIAPTTLMHLHTMVLTVKDKVNRDDIIN
TFLNTPRIILVNSSRTTVSSTAEIIEVSRDMGRVRYDIPEVVVFEDSIYTNGNEVFLMYG
VHQESIVVPENIDAIRASLGLMGKEESIKVTNDTLGIMKGYLL
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtggaaaaagttaaggtagctgtaaatggttacgggactattggaaaaagagtagctgat
gcgataagattacaaccagacatggaattaataggagttggtaaaacatcaccaaattat
gaggcaataattgccgataaaaaaggtataaagatatacacagtaaaagataatattggt
aaattcgaaaagtctggaatcagagttgcaggcaccattgaagatatggtaaaagaggct
gatatagtagtagatactactccaaacggagttggagcaacatataaacctttatatcaa
agtctcggaaagaacgccttatttcagggcggggaaaaagctgacgtagctgatatatca
ttctctgctttatgtaactatgatgaggctaaaggcaaaaaatatatcagagttgtctca
tgcaacacaactgggatgctaagaataatatgtacgatgaataagattagtaaagttgaa
aaagttagagctacaatagtgagaagagctgctgacccgaaagaggttaagagaggccct
ataaactctattgttccagatccagcaagtgtacctagtcatcatgctaaagatgttctt
actgtaataaaaggaattgatatagttacaatggctgttattgctcccacaactctaatg
catctacacacaatggttttaacagtgaaagataaggttaacagagacgacatcattaac
actttccttaatactcctagaataatcctggttaattcctcacgtacaacagtttcttct
actgctgaaattattgaagtttcaagagatatgggcagagttagatatgatatcccagaa
gttgttgtatttgaagattctatctatactaatggaaatgaagtattcttaatgtatggc
gttcatcaagagtctatagtagtcccagagaatattgatgctattagggcttcccttgga
cttatgggaaaagaggaatcaattaaagttacaaatgatactttaggaattatgaaaggg
tatctattatga

DBGET integrated database retrieval system