KEGG   Sulfurisphaera tokodaii: STK_13570
Entry
STK_13570         CDS       T00062                                 
Symbol
pgk
Name
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00002  Glycolysis, core module involving three-carbon compounds
sto_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_13570 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_13570 (pgk)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     STK_13570 (pgk)
Exosome [BR:sto04147]
 Exosomal proteins
  Proteins found in most exosomes
   STK_13570 (pgk)
SSDB
Motif
Pfam: PGK
Other DBs
NCBI-ProteinID: BAB66419
UniProt: Q971K1
Position
complement(1363837..1365084)
AA seq 415 aa
MIKVADLNIPVIEDFDINGRKVLLRIDINSPVDRKTGKLLDDSRIKAHAETIRELLDKQN
SVVIISHQGRPGDDDFISLEEHSKILSKYVGREIEFVDDVIGPYAREKISKLGKGEAILL
ENVRIVSEELIEAPPQQQSKTFLVRKLAPLVDFYINDAFATAHRSQPSLVGFPLVKPSAA
GRIMEKEVSALSKIFNKEDSPKIFVLGGSKVSDTLKIIEHLAKNRVADRILTGGLVAELF
AVAKGINLGKPNMQVLENKGLLSLIPRARKILLSGAPIEIPVDFTVEKPSGELSNDPENN
VSGIIKDIGNTTIEIYSSFIKEGKVITLRGPMGVIEDERFRIGTKSLLKASIESPGYVII
GGGHMISMLDKDVEINPNKIHVSTGGGALLLFLAGDKLPALEALHMSWVMQSGKS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgataaaagtagctgatcttaatattcctgttatagaagatttcgacataaatgggaga
aaagttttactaagaatagatataaattcacccgtagaccgaaaaactggaaaattatta
gatgattccagaattaaagcccatgctgaaacaattagagaattactcgataagcaaaat
tctgtagtaataatttcccaccaaggtagaccaggagatgatgattttatttctttagaa
gaacactctaaaatcctatctaaatatgttggtagggaaattgagttcgtcgatgatgtt
ataggtccttatgctagagaaaaaatatctaaactaggtaaaggggaagccatcttatta
gagaatgttagaatcgtatctgaagaattaatagaggctcctccacaacagcaatctaaa
acttttttagtaagaaaattagccccattagtcgatttttacattaacgatgctttcgca
acagcacatagaagccaaccaagtctagtaggatttcctttagtaaaaccttcagctgca
ggaagaataatggagaaagaagtttctgcattatctaagatctttaacaaggaagactct
ccaaaaatatttgttttgggaggaagtaaggttagtgatacattaaagataattgaacac
ctagcaaaaaatagagttgctgatagaatattaactggcggtttagtagcagaactattt
gctgttgcgaaaggtataaatttaggtaagcctaatatgcaagttttagagaataagggt
cttctgagcctaattccgagagctagaaaaatcttgctatctggtgcacctatagaaatc
cctgttgactttacagtggaaaaacctagtggagaattaagcaatgatccggagaataat
gtgagtggtattataaaagatatagggaatactaccattgaaatttattcctcttttatt
aaggaaggcaaagtcattacattaagaggacctatgggagttattgaagatgaaagattc
agaattggtactaaaagcttactgaaagcctctattgaaagcccgggatatgtaattatt
ggtggcggtcatatgataagtatgcttgataaagacgtagaaataaatccaaataaaatt
catgtatctaccggaggaggagcgttgcttttatttttagccggtgataagttaccggca
ttagaagctttacatatgtcatgggtgatgcaaagtggaaaaagttaa

DBGET integrated database retrieval system