KEGG   Sulfurisphaera tokodaii: STK_13690
Entry
STK_13690         CDS       T00062                                 
Symbol
nusG
Name
(GenBank) transcription elongation factor NusG
  KO
K15172  transcription elongation factor SPT5
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    STK_13690 (nusG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_13690 (nusG)
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_13690 (nusG)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     STK_13690 (nusG)
  RNA polymerase I system
     STK_13690 (nusG)
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    DRB sensitivity inducing factor (DSIF) complex
     STK_13690 (nusG)
SSDB
Motif
Pfam: Spt5-NGN KOW
Other DBs
NCBI-ProteinID: BAB66431
UniProt: Q971I9
Position
complement(1376635..1377093)
AA seq 152 aa
MERPRFSNYYAVRVTGGQEINVALMIEERIKTNNIKEVYSIIVPPNVKGYVILEATGPHV
VKLVSQGIRHVRGFAQGLVQKDDIIKFISKTTIAPAYKVGDMVEVTSGPFRGMQAQVVRI
DSAKNEVVLNILESSFPLQVTVPIDQVKPVKK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggaaaggcctagattctccaactattatgctgttagagtaactggagggcaagagata
aatgttgcattaatgattgaagaaagaataaagacaaataatataaaagaagtatattct
ataatagtaccacctaatgtaaaaggctatgtgattttagaagctactggaccccacgtg
gttaagcttgtatcgcaaggtataagacatgtcagaggatttgcacaaggtcttgtacaa
aaagatgatataattaaattcatttctaaaaccacaattgccccagcatataaagtaggt
gatatggtagaagttacttctggaccctttagaggtatgcaagctcaagtagttagaata
gatagtgccaaaaatgaagtagttttaaatattttagaatcatctttccccttacaagtt
acagttccaatagatcaagtcaaacctgtgaaaaaatag

DBGET integrated database retrieval system