KEGG   Sulfurisphaera tokodaii: STK_13710
Entry
STK_13710         CDS       T00062                                 
Symbol
pfdA
Name
(GenBank) prefoldin alpha subunit
  KO
K04797  prefoldin alpha subunit
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sto03110]
    STK_13710 (pfdA)
Chaperones and folding catalysts [BR:sto03110]
 Heat shock proteins
  GimC
   STK_13710 (pfdA)
SSDB
Motif
Pfam: Prefoldin DUF1664 DUF5917 MukF_M DUF3450 OmpH Herpes_UL36 ATG17_like Helo_like_N CENP-F_leu_zip H-kinase_dim MHB Tektin CENP-R KxDL HEF_HK
Other DBs
NCBI-ProteinID: BAK54546
UniProt: Q971I6
Position
complement(1378449..1378904)
AA seq 151 aa
MSNEENQQKVVVSLEDLLAQADALKKYIDYLQKTYAELQDNIMSIDSSLQALKELQNSQE
LLMVGDKRGNVIFKVQGIDKAKVLVHLGLEYYAEVDPDFATKVLNDKKSELSNVLSNVEK
ELAKSLEAYKEIADILNQAQQQLQAQQNKGG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagtaatgaagaaaatcagcaaaaagtagttgtctctttagaggatttattagcacaa
gcagatgcattaaaaaagtatattgattatttacagaaaacttatgctgaactacaagat
aatataatgtcaatagactcctcattacaagcattaaaagaattacaaaatagtcaagag
ctcttaatggtaggggacaaaagaggaaacgtaatattcaaggttcaaggtatagataag
gcaaaagttttagttcacttaggtctagaatattatgcagaagtagacccagattttgca
actaaagtattaaatgataaaaaaagtgaattatcaaacgttttaagtaacgtagaaaaa
gaattagctaaatctttagaagcctataaagaaatagctgacatacttaatcaagcacaa
caacaattgcaagctcaacaaaataaaggtggataa

DBGET integrated database retrieval system