KEGG   Sulfurisphaera tokodaii: STK_13870
Entry
STK_13870         CDS       T00062                                 
Symbol
glnA
Name
(GenBank) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00220  Arginine biosynthesis
sto00250  Alanine, aspartate and glutamate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00910  Nitrogen metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01230  Biosynthesis of amino acids
sto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STK_13870 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    STK_13870 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STK_13870 (glnA)
   00220 Arginine biosynthesis
    STK_13870 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STK_13870 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_13870 (glnA)
Enzymes [BR:sto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     STK_13870 (glnA)
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STK_13870 (glnA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-ProteinID: BAK54552
UniProt: F9VP44
Position
complement(1390703..1392124)
AA seq 473 aa
MPSLPKTAEEALKFLKDNKIKWVDLQFTDLPGRLHHITVPASEFTEDSFKTGFGKLDGSS
IKGFTMIYESDMVLMPIPQTMAVIPWNEGIARVITQVFWGGGKGRFERDPRHIAEEAEKK
QSEEGYISYFGPELEFFIFDKVDLDVATPQSGTGYKIHAREAPWARNGGFLIRYKEGYYP
APPVDQLMDIRVEAINILTDYFGFNIEATHHEVATAGQGEIDFRFSTLADTADKVQTLKY
VVKNVAAKHGMIATFMPKPMFGDNGTGMHTHFSLWTKDGKNLMYDPNDEYAELSQIGRYI
VGGILEHGRALSAIVSPTTNSYRRLIPGYEAPVYLVWSKSNRSAAIRIPSYYRGMEKAKR
LEYRPPDPSCNPYLAFAAILMAALDGIKKKIEPGDPVDENVYHMSEERKKQLKIKELPRS
LDEALDELESDNEFLKPVFNSSILNTYIDLKRDEAKTMQQYPHPMELYYYLDA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgccaagtttacctaaaacagccgaagaggctctgaaatttctaaaagacaataaaata
aaatgggtggatctacagtttacagatctacctggaagattgcatcatattacagtccca
gcctcagaatttacagaagattcatttaaaacagggtttggaaaattagatggaagtagt
ataaaaggatttactatgatttatgaaagcgatatggtgctaatgcccataccacaaact
atggcagttataccttggaatgaaggaattgctagagttataacccaggtattttgggga
ggaggaaagggaagattcgagagagatccaagacatattgcagaagaagcagaaaagaaa
caatcagaagaaggttatattagttattttggcccagagctagaattctttatatttgat
aaagtagatttggatgtagccacacctcaaagcggaactggatataaaatacatgctaga
gaagccccatgggctagaaatggagggttcctaataagatacaaagagggttattatcca
gcaccacctgtagatcagctaatggatataagagtcgaggctattaatatattaactgat
tactttggattcaatatagaagctactcaccatgaagttgctacagctggacaaggcgaa
attgatttcagattctctacattagctgatacagccgataaagttcaaacactaaaatat
gtcgtaaaaaatgtagcagcaaagcatggaatgatagccacttttatgccaaaaccaatg
tttggagataatgggacaggaatgcatacgcattttagtctatggacaaaagatggaaag
aatctaatgtacgatcctaacgatgaatatgctgagttaagtcaaataggtagatatata
gtaggaggaatattagaacatggtagagcattatcagcaatagtatcgccaaccacaaat
agttatagaagattaattccaggttatgaggcacccgtatatctagtgtggagtaaatcc
aacagaagtgctgcaattagaataccatcatattatagaggaatggaaaaagcaaagaga
ttagaatatagaccaccagatccctcgtgtaacccatacttggcattcgctgcaatacta
atggctgctttagatggaataaagaaaaagattgagcctggtgatcctgttgatgaaaat
gtatatcatatgagcgaagagaggaaaaaacagttaaaaattaaggaattacctagatca
ttagatgaagcattagatgagttagaaagcgacaatgagttcctaaaaccagtatttaat
tcatcaatattaaatacatacattgacctaaagagagacgaagcaaaaactatgcaacag
tatcctcatcctatggagttatattactatttagatgcctaa

DBGET integrated database retrieval system