KEGG   Sulfurisphaera tokodaii: STK_14230
Entry
STK_14230         CDS       T00062                                 
Symbol
gltX
Name
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00860  Porphyrin metabolism
sto00970  Aminoacyl-tRNA biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    STK_14230 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STK_14230 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sto01007]
    STK_14230 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_14230 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sto02048]
    STK_14230 (gltX)
Enzymes [BR:sto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     STK_14230 (gltX)
Amino acid related enzymes [BR:sto01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   STK_14230 (gltX)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STK_14230 (gltX)
 Prokaryotic type
   Other AARSs
    STK_14230 (gltX)
Prokaryotic defense system [BR:sto02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    STK_14230 (gltX)
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C tRNA-synt_1c_C2 tRNA-synt_1e DRY_EERY DUF4635
Other DBs
NCBI-ProteinID: BAK54565
UniProt: Q971D0
Position
1426222..1427922
AA seq 566 aa
MEEIEELIYKYALQNAYKHGGKAQDKAVVSKIFVERPDLRSRAKEISEIAKKIVEKVNSM
SIQDQERELKEKYPDLLEEKKKEEPEKKTLPPIKVEGKFVTRFAPNPDGPIHLGNARAAI
ISYKYAEMYKGEFILRFDDTDPKVKKPIKEAYDWIRKDLKWLGIKWDKEVKASERLEFYY
SMAKELISKGFAYVDTCSEEEFKKMRDASKPCPNRLKSAEDNLYLFEKMLNGEFKEGEAV
VRIKTDLSLPDPSQRDWVLLRIIDVKKNPHPITGDKYWIWPTYNFASALDDHDLGITHIF
RGKEHEVNAEKQKWIYNYMGWKYPYVEEFGRLRLEGFMMSKSKIRTVLEKGVSIDDPRLP
TLAGLRRRGILPETIIETIITVGLKVSDATISFDNLAALNRKKLDPIAKRLMFVQQPKEF
IIELSEPIRAKIPYNPSKPSEYREILVNPGDKILLDAKDAEEGAVVRLMELCNVTISGNK
LIFHSKTLEDAKKLNAKIIQWVKKDEASNVEVIIPDPNEEKPPISGYGEKEIGNLKINEI
VQFIRFGFVRVDNKIDNKVTVIFSHE
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggaagaaattgaggaattaatatataaatacgcgctacaaaatgcttataaacacggt
ggtaaagcgcaagataaagctgttgtaagtaaaatttttgttgagcgtcctgatttaaga
tctagagctaaggaaatatctgagatagcaaagaaaatagtagaaaaagtaaattcaatg
agtattcaagaccaagagagagaacttaaagaaaaatatccagatttactcgaagagaaa
aaaaaggaagaaccagaaaagaagactcttcctccaattaaagttgaagggaaatttgtt
acaagatttgcgccaaacccagatggtccaattcacttaggcaatgctagagcggctatt
atatcttataaatatgctgaaatgtataaaggtgagtttatcctaaggtttgacgatact
gatccaaaggttaaaaagccaataaaagaggcgtacgattggattaggaaagatcttaaa
tggttaggtataaagtgggataaggaagttaaagcgtcagaaagactagaattctattac
agtatggctaaagagcttataagtaaaggttttgcatatgttgatacttgctcagaggaa
gagttcaaaaaaatgagagatgctagtaaaccttgtccaaataggttaaaatcagcggag
gataatctttacttatttgagaagatgcttaatggagagtttaaagaaggagaagctgta
gtaaggataaaaactgatctctctttacctgatccatcgcaaagagattgggttttactt
cgaataatagatgttaagaaaaaccctcatcctatcactggagataaatattggatttgg
cctacttataatttcgcaagtgccttagacgatcatgacttaggtataactcacattttc
agaggtaaagaacatgaagtaaatgcagaaaaacagaaatggatatacaactacatgggc
tggaaatatccttatgttgaagaatttggtaggcttagattagaaggatttatgatgagt
aaatcaaagattagaacagtattagagaaaggcgtaagcattgatgatcccagattacct
acgttggctggattgaggagaagaggaattctaccagaaacaataatagaaactataatt
acagtaggtttaaaggttagtgatgcaactataagttttgacaatttagctgcacttaat
agaaagaagttggatccaatagctaagagacttatgttcgttcaacagcctaaggagttt
attattgagttatcagaaccaattagggcaaaaataccatataaccctagtaaaccttca
gaatatagagaaattctagtaaatcctggagataagattcttcttgacgcgaaggatgca
gaagaaggtgcggtagtaaggttaatggaactttgcaatgtcacaatttctggaaataaa
ttaatatttcatagcaaaactttggaagacgcgaagaaattaaatgcaaaaatcatacaa
tgggtaaaaaaagatgaagcttctaacgttgaggtaattataccagatccgaatgaagag
aagccacctatatccggttatggagaaaaagaaattgggaatctaaaaatcaatgaaata
gtacagttcataagatttgggttcgttagggtcgataataagatcgataataaggttacc
gtaatattctcacatgagtaa

DBGET integrated database retrieval system