KEGG   Sulfurisphaera tokodaii: STK_14260
Entry
STK_14260         CDS       T00062                                 
Symbol
polB1
Name
(GenBank) DNA polymerase
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STK_14260 (polB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_14260 (polB1)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STK_14260 (polB1)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     STK_14260 (polB1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_exo2 RNase_H_2 ACT_6
Other DBs
NCBI-ProteinID: BAK54566
UniProt: F9VP58
Position
1429820..1432450
AA seq 876 aa
MARQITLFDFTLKKEQNKDESRKEEIPHANINEERRKPKEWIKEAEEGKSYFLLQVDYDG
KKSKAVCKLYDKETKKIYILYDNTGHKPYFLTDIDPEKVNKIPKVVRDPSFDHLETVIKI
DPYSGNKIKLTKIVVKDPLAVRRMRNSVPKAYEAHIKYFNNYIYDLGLIPGLPYVVKKGK
LEQVRPELKGEEVDEIRKAFADSDEMTKEAVNDWIPIFESEVPDVKRVAIDIEVYTPIKG
RIPDPEKAEFPIISISLAGNDGTKRVLVLLREDVNSQITKHDVIVETFKSERELIRRFFD
IILDYPIILTFNGDDFDIPYIYYRALKLNFTPEEIPFDIINDEGKYLAGIHIDLYKFFFN
RAIRNYAFEGKYNEYNLDAVATALLGMSKVKLDTLISFLDLDKLIEYNSRDAEITLKLTT
FNNNLVWKLIILLARISKMGLEELTRTEVSTWIKNLYYWEHRRRNWLIPLKEEILTRSSQ
IKTAAIIKGKRYKGAVVIDPPAGVFFNVVVLDFASLYPSIIRNWNISYETVDVENCKNKE
YVRDETGEVLHYICKDKPGITAVITGLLRDFRVKVYKKKAKSQNISEEQRSVYDVVQRAM
KVFINATYGVFGAENFPLYAPAVAESVTAIGRYVITTTVNYCRSIGLQVLYGDTDSMFLW
NPSKEKLEEIIKFVKGKFGLDLEVDKIYKFVAFSGLKKNYLGVYPDGKTDIKGMLAKKRN
TPEFIKKEFNEVKQLVTTINSPDDIPKIRDQLEYKIKEIYEKLRHKGYNLDELAFRVMLS
KPLESYTKNTPQHVKAALQLRSYGVMVLPRDIIMFVKVKSKDGVKPVQLAKLSEIDVDKY
IDAVRSTFEQILKAFGINWGQFTTTSIDTFFNISKK
NT seq 2631 nt   +upstreamnt  +downstreamnt
atggcaagacaaattacactttttgattttacattgaagaaagaacaaaataaggatgaa
agtagaaaagaagagatcccgcacgctaatatcaacgaagagaggagaaaacctaaggag
tggataaaggaggctgaagaagggaagagttatttcttacttcaagttgattatgatggc
aaaaaatcaaaagctgtttgcaaactctatgacaaggagacgaaaaaaatatacatatta
tatgataatacaggccataaaccttattttcttactgatatagacccagaaaaagttaat
aaaattcctaaagttgtaagagatccttcttttgatcatttggaaacagtaattaagata
gacccttattctggtaataagataaaacttacaaaaatagttgtaaaagacccattagct
gtaagaaggatgagaaactctgttccaaaagcttacgaagctcatatcaaatattttaac
aattatatctatgatttaggccttataccaggtttgccttatgtagtgaaaaaagggaaa
ttagagcaagtaagaccagaacttaaaggagaagaagtagatgagataagaaaagctttt
gctgattctgatgaaatgactaaagaagccgttaacgattggattcctatttttgaatct
gaagttcctgatgtgaaaagagtagcaatagatatagaagtatatactcctattaaggga
cgaattccagatccagagaaagcagaatttcctataataagcatatccctagctgggaat
gatggtactaaaagagttctagtcctacttagggaggatgtaaattctcaaattactaag
cacgatgtgattgtagaaacatttaaatctgaaagagaattaattagaagatttttcgat
ataattcttgattatccaattatactgacatttaatggtgatgatttcgatattccatat
atttattatagggctttaaagcttaattttaccccagaagaaataccatttgatataata
aatgatgagggaaaatatttagcaggtattcatatagatttatataaatttttctttaat
agagcaataagaaattatgcatttgaaggaaaatataatgagtataatctagatgcagta
gccacagcactattaggaatgtctaaagttaagcttgatacattaatcagtttcttagat
cttgataaactgatagaatataattcaagagatgctgaaataactcttaaattaactaca
tttaataataatttggtatggaaattaattatattattagcaagaatatcaaagatggga
ttagaggaattaactagaactgaagtttctacttggattaaaaacttatattattgggaa
cataggagaagaaactggcttattccattaaaagaagaaatactaactagatcaagtcag
attaagactgcagctataataaaagggaagaggtataagggtgctgtagtaattgatcca
ccagctggtgttttctttaatgtcgttgttcttgattttgcatcactgtatccatcaatt
attaggaattggaacataagttacgaaactgttgatgtagaaaattgtaagaacaaagaa
tatgtaagagatgaaactggtgaagttttacattatatatgtaaagataagccgggtata
acggctgtaattacaggtttgttgagagattttagagttaaagtttacaagaaaaaggca
aagtcacaaaatatatctgaagagcagagatcggtttatgatgtagtgcaaagagcaatg
aaagtattcataaacgcaacttatggtgtatttggtgctgagaatttcccactatatgct
cctgctgttgctgaaagtgttactgcaataggtagatatgttattactacaacggtaaac
tattgtaggtcaattggtttacaagttttatatggcgatactgattcaatgtttttatgg
aatccatctaaagagaaattagaagaaataataaaatttgtaaagggtaaattcggttta
gacttagaagtagataaaatatataaatttgtagcattttctggtctaaagaagaactat
ttaggtgtttatcctgatggaaaaacagatattaaaggtatgttagccaagaagagaaat
actccggagttcattaaaaaagagtttaacgaagttaagcagcttgtcactactataaat
tccccagatgatatacctaagataagagatcaattggagtataagattaaggagatatac
gagaaattaagacataagggttacaatcttgatgagctggcatttagagtaatgttatct
aagcctttagaaagttatactaagaatacaccacaacatgttaaagctgcattacaatta
agatcttatggtgtaatggttctacctagagatataataatgtttgttaaagtgaaaagc
aaagatggtgtaaaacctgttcaacttgcaaaactgagtgagatagatgtggataaatat
attgatgcagtaagatcaacatttgaacaaatactaaaagcgtttggtattaattgggga
caatttactacaacttctatcgatactttctttaacataagtaaaaagtag

DBGET integrated database retrieval system