KEGG   Sulfurisphaera tokodaii: STK_14320
Entry
STK_14320         CDS       T00062                                 
Symbol
metG
Name
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00450  Selenocompound metabolism
sto00970  Aminoacyl-tRNA biosynthesis
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    STK_14320 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STK_14320 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sto01007]
    STK_14320 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_14320 (metG)
Enzymes [BR:sto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     STK_14320 (metG)
Amino acid related enzymes [BR:sto01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   STK_14320 (metG)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STK_14320 (metG)
 Prokaryotic type
   Other AARSs
    STK_14320 (metG)
SSDB
Motif
Pfam: tRNA-synt_1g Anticodon_3 tRNA-synt_1 Anticodon_1 DZR_2 Terpene_synth DZR
Other DBs
NCBI-ProteinID: BAK54568
UniProt: Q971C1
Position
1435295..1437010
AA seq 571 aa
MKIFVASAWPYVNAVPHLGNLIGSVLSADVFARYARLKYGQENVVFVSGSDEHGTPIEVE
AKKRNVNPKELTDQAHEYDKKLFLDVWEISYNNYTRTESEIHKTFVRDFMLKLEKYIKIE
EDEIPYCEYDKIYLPDRFVKGTCPYCGFEDARGDQCDNCGRLLTPRLLVNPKCVLCGRTP
VFKKTKHWFFDLSAFNDKIEEWIKNSQTLPENVKSVALSWVKEGLKPRSITRDNAWGIPA
PFEGAEGKTIYVWFEALLGYISATIEYFKKIGKEEEWKKFWFGNDVKSYYFIGKDNIPFH
AVILPAMLMASGENYVLPTVIAATEYLLYEGQKFSKSRKIGVWIDEAPQLLDIEYWRFIL
IRLRPEERDTNFTWREALRIVNTELNDDIGNYANRVLSMVRRYFNGEVPQIKYEKLKDED
TKFISEIKEAPKKMSELFELGKLKAGSEEILKLARNGNSYLNIRAPWNLIKNDKEEAGNV
LNIAVNSLRTLSIMLYPLMPKSAEKLYNMLGFKDIEREKWDLAGELVIKSNHKINEVSVL
FKKVELNENDINKKLDEIRKNLEKIRPTLLR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgaagatatttgtagcctctgcatggccttatgtaaatgcagtaccacatctaggtaat
ttgattggatcagtattatctgctgatgtttttgctagatatgcaaggttaaaatatggc
caagagaatgtggtatttgtaagtggaagtgacgagcacggaacaccaattgaggtagaa
gctaagaagagaaatgtgaatcctaaagagctaaccgatcaagcacatgaatacgataaa
aagttatttttagatgtgtgggagattagttataataattacactagaacagaatcagaa
attcataaaacttttgtcagagattttatgttaaaactagaaaaatatataaagattgaa
gaagatgaaattccatattgtgagtatgataaaatttacttaccagatagatttgtgaaa
ggtacttgtccttattgcggatttgaagatgcaagaggagatcaatgcgataattgtggt
agactattaacgccaagacttctagttaatcctaagtgcgtattatgtggaagaacgcca
gtatttaagaaaactaaacactggttttttgatctttcagcatttaatgataaaattgag
gaatggattaagaattctcagacactacctgaaaatgttaagtcagtagccttaagttgg
gttaaagaagggctaaagccaagaagcattacgagagataatgcttggggtattccagca
cctttcgaaggtgctgaaggtaaaactatctatgtatggtttgaggcattattaggttat
atctctgctacgatagaatattttaagaagataggaaaagaagaagagtggaagaaattc
tggtttggaaatgatgttaaaagttattactttattggaaaggataacattccattccat
gctgtaatattaccagcaatgctaatggcttctggagaaaattatgttttacctacagtt
atagcggcaacagaatatttgctttatgaagggcaaaaattcagtaaaagtaggaaaatt
ggggtatggattgatgaagctcctcaattattagatatagaatactggagatttatattg
attagacttagaccagaagagagagacactaattttacatggagagaagcactaaggata
gttaatacagaattaaatgatgatataggtaactatgcaaatagagtattgagtatggta
agaagatactttaatggagaggttcctcaaataaaatatgaaaaactaaaagatgaggat
actaaatttattagtgaaataaaagaagctcctaaaaagatgagtgaattatttgagcta
ggaaaattaaaggccggaagtgaagaaatattaaagttagctagaaatggtaactcatat
ttaaacataagagcaccttggaatttgataaagaacgataaagaagaagctgggaatgtc
ttaaatattgctgttaattctcttaggacattatctatcatgctatatccattaatgcca
aagagtgccgaaaaactatataacatgttagggtttaaagatatagagagagaaaaatgg
gatctcgctggagaacttgttattaagtctaatcataaaattaatgaggtaagcgttctg
tttaaaaaagtcgaactaaatgagaatgatataaataaaaaattagatgaaataagaaag
aacttagaaaaaataagacctaccttattgcgttaa

DBGET integrated database retrieval system