KEGG   Sulfurisphaera tokodaii: STK_14650
Entry
STK_14650         CDS       T00062                                 
Symbol
hisE
Name
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00340  Histidine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    STK_14650 (hisE)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     STK_14650 (hisE)
SSDB
Motif
Pfam: PRA-PH MazG TcdA_TcdB_pore DUF6193 PhoD_2
Other DBs
NCBI-ProteinID: BAK54590
UniProt: Q970Y8
Position
1468195..1468479
AA seq 94 aa
MSSNVLDTLYSIILDRISNKKEGSYTVKLLEKGKPYIARKVGEEATEVIVASLSEGRERF
ISEVADLIYHLFVLMAVEGVKPEDVYEELKRRMK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgagtagtaatgtattagatacgctatattccattattttagataggataagcaataag
aaggaaggtagttatactgtaaaattgctagaaaaaggtaaaccttatatagctagaaaa
gtgggtgaggaagctacggaagtaattgtggcttcattaagtgaaggaagagagagattt
attagtgaagtagcagacttaatatatcatcttttcgtattaatggctgtagaaggagtt
aagccagaagatgtttatgaggagctaaaaaggaggatgaagtga

DBGET integrated database retrieval system