KEGG   Sulfurisphaera tokodaii: STK_14670
Entry
STK_14670         CDS       T00062                                 
Symbol
hisI
Name
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00340  Histidine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    STK_14670 (hisI)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     STK_14670 (hisI)
SSDB
Motif
Pfam: PRA-CH LpxI_N W_rich_C
Other DBs
NCBI-ProteinID: BAK54592
UniProt: Q970Y6
Position
1469069..1469425
AA seq 118 aa
MKLSENEASKLIEKLWFRHTDSTIIAVLQDYKTKEVLMVGHMNREAVFKTLTTGYVHFWS
LSRKKLWLKGETSGHFQLVEDFKIDCDGDAMVFLVKSVGPVCHTGNRSCFYRNFSDLI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaaactaagtgagaatgaagcctctaagttaatagaaaaattatggtttaggcataca
gattctactataatagctgttcttcaagattataaaactaaagaagttctaatggttggg
catatgaatagagaagcagtttttaaaactttgacaactggatatgttcatttttggtca
ctaagtaggaagaagttatggttaaaaggagagactagtggccattttcaattagttgaa
gattttaaaattgattgtgatggagatgctatggttttcttagtcaaatcagttggtcct
gtatgtcatactggaaataggagttgcttctataggaatttttcagatttaatttaa

DBGET integrated database retrieval system