KEGG   Sulfurisphaera tokodaii: STK_14690
Entry
STK_14690         CDS       T00062                                 
Symbol
serS
Name
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STK_14690 (serS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sto01007]
    STK_14690 (serS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_14690 (serS)
Enzymes [BR:sto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     STK_14690 (serS)
Amino acid related enzymes [BR:sto01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   STK_14690 (serS)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    STK_14690 (serS)
 Prokaryotic type
    STK_14690 (serS)
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N DUF5930 ALIX_LYPXL_bnd Cep57_MT_bd
Other DBs
NCBI-ProteinID: BAK54593
UniProt: Q970Y4
Position
1469902..1471263
AA seq 453 aa
MSWSILELVRNNPDKLKEYIKRRFIDVSLVDRAVELDKKWRQTLQEVEKLRHEHNVISSS
IPKAKPEERQELIKKAKELLKALEEKEKELDNIENERDNILMQLPNIVDDSAPIGPDETY
SVPIRFWGKFKVYEKDEAEFLSQLKGNRVDYEIIHWKPVGHADMLENVLKLGDTKKAAEV
SGARFYYLFDDIVWLDIALLNYAIDTMTSKGYTLVLPPYMLRGEVIKSVIDLDTFKDAIY
KIENEDLYLIATAEHPIAALYFKEEIPKEKLPLKYVGISPAFRKEAGAANKDLKGIFRVH
QFHKVEQFIFSSPEDSWKLHEELIRNAEEIFQGLGLPYRVINIATGDLGACAAKKYDLEV
WMPAQAKFREMVSCSNCLDWQAYRMRIRYVEKGGKKGYVHTLNSTAIASTRTITAILENY
QREDGVVEIPKVLKKYLEPFSRAPKDYIYPRKE
NT seq 1362 nt   +upstreamnt  +downstreamnt
gtgtcttggagtatattagagttagttagaaacaatccggataaacttaaggaatatata
aaaagaagatttatagatgtctctttggttgatagagctgtagaattagataagaaatgg
agacaaacactacaagaagtagaaaagctaaggcatgagcacaatgttataagctcctct
attcctaaggccaaaccagaagagagacaagagttgataaagaaagcaaaagaattatta
aaggcattggaagaaaaggaaaaagagctagataatatagagaatgaaagagataatata
ttaatgcaattgcctaatatagtagatgattctgctcctatagggcctgatgaaacatat
agcgttcctataagattttgggggaaatttaaagtatacgaaaaagatgaagctgagttt
cttagtcaattaaaaggaaatagggttgattatgaaattatacattggaagccagttgga
catgcagatatgttagaaaatgttctaaaactaggagataccaagaaagcagcagaagta
tctggtgccagattctactatttatttgatgacatagtttggttagatattgcattactt
aattatgcaatagacacgatgacaagtaaaggatatactttagtacttcctccatatatg
ttaagaggggaggtcataaagagcgttattgatttagatacatttaaggacgcaatttat
aagatagaaaatgaagatctttatcttattgctaccgcagaacatccaatagcggcccta
tactttaaggaggaaatacctaaagagaaacttccattaaaatatgttggtataagtcct
gcatttaggaaagaagctggagctgcaaataaggatttgaaaggtatatttagggttcat
cagtttcataaagtggagcaatttatcttttcatctccagaagatagttggaaattacat
gaagaattaataaggaatgcagaagagatatttcaaggattaggattaccatatagggtc
ataaatatcgcaactggtgacttaggtgcatgtgcagctaaaaagtatgatttagaagta
tggatgcccgcacaagctaagtttagagagatggtaagttgtagtaattgtcttgattgg
caagcatatagaatgaggataagatatgtagaaaagggaggtaagaaaggttatgtacat
acgctaaatagtactgctatagctagtactaggactataacagcaatccttgaaaattac
cagagagaagatggtgtagttgaaatacctaaagtgctcaaaaaatacttagaaccattt
agtagggctcctaaagattacatatatcctagaaaagaataa

DBGET integrated database retrieval system