KEGG   Sulfurisphaera tokodaii: STK_14860
Entry
STK_14860         CDS       T00062                                 
Name
(GenBank) putative ArsR family transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_5 HTH_20 HTH_24 TrmB HTH_29 HTH_11 HTH_40 HTH_45 HTH_IclR TnsD
Other DBs
NCBI-ProteinID: BAB66557
UniProt: Q970W6
Position
complement(1483071..1483379)
AA seq 102 aa
MNEKELRQIKKLFKFLFLTSRGGNTRLKIVRLLEEKPLNANQIANSLGLDYKTVIHHLEV
LIENQIVYKDGEGYGAPYKLTTFFKMYKSALDSLLLEESKNS
NT seq 309 nt   +upstreamnt  +downstreamnt
gtgaatgaaaaggaattacgccagataaagaaactttttaaatttctctttcttacctct
agaggaggaaatacacgtttaaaaatagttagattacttgaggaaaaacctcttaatgca
aatcaaatagctaattctttagggctagattataaaactgttattcatcacttagaagta
ttaattgaaaatcaaattgtatataaagatggagagggttatggagcaccatacaaacta
actacattttttaaaatgtataaatctgcattggacagtttactcctggaggagtctaaa
aattcttaa

DBGET integrated database retrieval system