KEGG   Sulfurisphaera tokodaii: STK_14920
Entry
STK_14920         CDS       T00062                                 

Definition
(GenBank) tRNA-binding protein
  KO
K06878  tRNA-binding protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STK_14920
SSDB
Motif
Pfam: tRNA_bind
Other DBs
NCBI-ProteinID: BAB66563
UniProt: Q970W0
Position
complement(1487332..1487673)
AA seq 113 aa
MSEITIDDFAKLDLRVGIVKSAERIEGTRLLKLIVDLGSESRQIISGIAEFYTPEELVGK
RVILIANLKPKKIRGFESQGMILAAGCKEDEEKGIKPRILTVDGEVPAGTKVC
NT seq 342 nt   +upstreamnt  +downstreamnt
atgagtgaaattacaatagacgactttgcaaaattagatttaagagtaggaattgtaaag
tcagctgagaggatagaaggaactagattactaaaattaatcgttgatttaggcagtgaa
tctaggcagattatttctggtatagctgaattttacacgccagaagaattagtgggaaaa
agagtcatactcatagctaatttaaagcctaaaaaaataagaggatttgaaagtcaggga
atgatattagctgctggttgtaaagaagatgaggagaaaggaataaaacctagaatactt
acagtagatggggaagttcccgcaggaacaaaagtatgttaa

DBGET integrated database retrieval system