KEGG   Sulfurisphaera tokodaii: STK_14940
Entry
STK_14940         CDS       T00062                                 
Symbol
purQ
Name
(GenBank) phosphoribosylformylglycinamidine synthase I
  KO
K23265  phosphoribosylformylglycinamidine synthase subunit PurQ / glutaminase [EC:6.3.5.3 3.5.1.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00220  Arginine biosynthesis
sto00230  Purine metabolism
sto00250  Alanine, aspartate and glutamate metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STK_14940 (purQ)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STK_14940 (purQ)
   00220 Arginine biosynthesis
    STK_14940 (purQ)
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    STK_14940 (purQ)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     STK_14940 (purQ)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     STK_14940 (purQ)
SSDB
Motif
Pfam: GATase_5 DJ-1_PfpI GATase_3 GATase DUF6506 DUF2141
Other DBs
NCBI-ProteinID: BAK54601
UniProt: F9VNF5
Position
1488738..1489409
AA seq 223 aa
MKTAVIKFPGTTCEIDVYKALLEAGVEAEIVKYKDFDPDKYSAVILPGGFSFGDYLRAGS
IAASTETIKKVKEMADEGKIVIGICNGFQILVESGLLEGALLPNLNLRFISKWVYLRVVR
FDTAVTRGLNKTILKMPIAHAEGRFYLDNVEKAKKYAVMLYCDENGNVNDMVNPNGSILN
IASIANEEGNVIGMMPHPERASFKLTSITGETDGLLLFKGLRK
NT seq 672 nt   +upstreamnt  +downstreamnt
ttgaagacagcagtaattaaattccctggtacaacatgtgagatcgacgtttacaaggct
ctgttagaggctggagtagaagctgaaattgtaaaatataaggattttgatcccgataag
tatagtgcagttattttgccaggaggttttagttttggtgattatcttagagctggtagt
attgccgctagtacggaaacaattaagaaagttaaagaaatggcggatgagggtaaaatt
gtaatcggaatatgcaacggatttcaaatattggttgaaagtggtctcttagaaggtgct
cttttacctaacttaaatttgcgttttatcagtaagtgggtttacttgagagtcgttaga
tttgatacagctgtaactcgtggattaaataagactattctaaaaatgcctatagcacat
gcagaagggagattttatttagataatgtagagaaagcaaagaaatatgctgttatgtta
tattgtgacgaaaatggtaatgtgaacgatatggtaaatcctaatggttcaattctcaat
atagcttcaattgctaatgaagaaggaaatgtcataggcatgatgccacatccagagagg
gcatctttcaaattaacctctataacgggtgaaactgatggattattattatttaagggg
ttaagaaaatga

DBGET integrated database retrieval system