KEGG   Sulfurisphaera tokodaii: STK_15290
Entry
STK_15290         CDS       T00062                                 

Gene name
argE
Definition
(GenBank) putative acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00300  Lysine biosynthesis
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    STK_15290 (argE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sto01002]
    STK_15290 (argE)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STK_15290 (argE)
Peptidases and inhibitors [BR:sto01002]
 Metallo peptidases
  Family M20
   STK_15290 (argE)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-ProteinID: BAB66600
UniProt: Q970S3
Position
1521606..1522754
AA seq 382 aa
MEIEELTSKLIQFPTVNPPAENLHDCASFIKDYLSSQGFSSQVIEFEKGWPVVISENGNK
NDKLIMLNGHYDVVPTGDVNKWKYNPFSGKIIDDKVYGRGSTDMKGGLAVFMKVFTEIAD
KVNYNLIFTAVPDEESGGDKGSKYLADRYKPDLVLISEPSGSDSINIGEKGLLQVKLIAK
GKVAHGSLPSLGENAIMKLVKDLIQLEKIKEIEIKIPDNLIEAMTARIPSEIAKNDVLRI
SFNPGVIKGGVKVNVVPDYAEVEVDMRIPPGINSGEALNIVRSLVKQGEIIPLDISEPNY
TPPDNEFVKKLENIIYKQLGIKAKKYIITGATDGRYFRYKGVPVIVYGPGELGMAHAYDE
FISFKELRNSYTVIKDYLLTLF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaaatagaggaattaacctcaaaattaattcaatttcctacagtaaatccaccagct
gaaaacctacatgattgtgcctcatttataaaagattatctttcatctcagggtttttca
tctcaagttatagagtttgaaaagggctggccagttgttatttccgaaaatggcaataaa
aatgacaagctaataatgttaaacggccattatgatgttgtccctactggagatgttaat
aagtggaaatacaatcctttttctggaaagatcattgatgataaagtttacgggcgagga
agtactgatatgaaaggaggcttagccgttttcatgaaagtatttactgaaatagccgat
aaagttaattataaccttattttcacagctgttccagatgaagaaagtggtggtgataaa
gggtcaaaatatttagctgatagatataagccagatttagtactcatatctgaaccatcc
ggttcagattctataaacattggtgaaaaagggctattgcaagtaaagttaatcgctaaa
ggtaaggttgctcatggaagtcttccatctttaggtgaaaatgcaataatgaaactcgtt
aaggatttaattcaacttgaaaaaataaaagagattgaaataaaaatcccagataatctc
atagaagcgatgacagcaagaataccttccgaaattgctaagaatgatgtattgaggatt
tcctttaatcccggtgtaattaaaggcggagttaaggttaatgtagttccagattacgct
gaagttgaagttgatatgagaatacctcctggaataaatagtggtgaagcattaaatatt
gtaaggagtcttgtgaaacaaggtgaaataatacctctagatatctcagagcctaattat
actcctccagataatgagtttgtgaaaaaattggaaaatattatatataaacagctagga
attaaagctaagaaatatattattactggtgctacagatggtagatattttagatataaa
ggagttccagtaatagtttacggtccaggagagctaggtatggctcacgcttatgacgag
tttatttcatttaaagaattaagaaattcctatactgttataaaagattatttattaacc
ctcttctag

DBGET integrated database retrieval system