KEGG   Sulfurisphaera tokodaii: STK_15310
Entry
STK_15310         CDS       T00062                                 
Name
(GenBank) 2-oxoacid--ferredoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00020  Citrate cycle (TCA cycle)
sto00620  Pyruvate metabolism
sto00640  Propanoate metabolism
sto00650  Butanoate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01210  2-Oxocarboxylic acid metabolism
Module
sto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_15310
   00020 Citrate cycle (TCA cycle)
    STK_15310
   00620 Pyruvate metabolism
    STK_15310
   00640 Propanoate metabolism
    STK_15310
   00650 Butanoate metabolism
    STK_15310
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_15310
   00680 Methane metabolism
    STK_15310
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    STK_15310
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     STK_15310
SSDB
Motif
Pfam: POR MHC_II_beta
Other DBs
NCBI-ProteinID: BAB66602
UniProt: Q970S1
Position
1524122..1524667
AA seq 181 aa
MLIEIALRGRGGQGVVTAGELMVKATVLEDKYAQSIPFYGGERRGAPVVSFLRLSDKPVL
LHREVYNPDGVAVFDPSLTKIMDVTQGIKEDGFLLINTSEAKKIWKNEYIVDATSIAKDL
GLVIAGWAVVNTTMIGALAKILGMPSLTSLEEAIKEEFPGKLGELNAEAVERGYKEVKKV
D
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcttatcgaaatagccttaagaggtagaggagggcaaggagtagttaccgcgggagaa
ttaatggttaaagcgacagttcttgaggataagtatgctcagtcaattcccttttatgga
ggagaaagaagaggagctccggttgtatcatttttacgtctctcggacaaacctgttctt
ttacatagggaagtatataacccggatggagtagcagtttttgatccttccttaactaaa
attatggatgtaacacaaggcataaaagaagacggtttcttattaattaacacatcagaa
gcaaagaaaatttggaaaaatgagtatattgtggatgcaacatcaattgctaaagattta
ggcttagtaatagctggatgggcagtagtcaatactacaatgattggcgctttagctaaa
attttaggaatgccttctttaacttccttagaggaagcgataaaagaagaatttcctgga
aagcttggcgaattaaacgcagaagctgttgaaagagggtataaagaggtgaaaaaagtt
gattaa

DBGET integrated database retrieval system