KEGG   Sulfurisphaera tokodaii: STK_15370
Entry
STK_15370         CDS       T00062                                 
Name
(GenBank) ADP-forming acetyl-CoA synthetase
  KO
K24012  acetate---CoA ligase (ADP-forming) [EC:6.2.1.13]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00620  Pyruvate metabolism
sto00640  Propanoate metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_15370
   00620 Pyruvate metabolism
    STK_15370
   00640 Propanoate metabolism
    STK_15370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sto01004]
    STK_15370
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     STK_15370
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STK_15370
SSDB
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding Ligase_CoA_2 ATP-grasp_2 GFO_IDH_MocA GARS_A DUF6577 F420_oxidored RimK ATP-grasp CPSase_L_D2 NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: BAB66609
UniProt: Q970R4
Position
complement(1530831..1532810)
AA seq 659 aa
MSLEYLFKPKSIAVIGASRYKEKVGNVVFRNLLYTYHGKLYPVNSKAEDVEGVKAYKSVK
EIPDPIDMVVITVPREAVPQVMEEAVEKNVKAAIVITAGFKEVGEAELEDKVISIARKGG
IRVLGPNTFGIITPEFNATFAYTDVKRGNIALVVQSGGLGVYMLNWAQKYRVGISYMVSL
GNQADVKEYEVIEYLSRDPETRAIFVYLEGVSDGNSFLETLPEATKRKPVVFLKGGTTSN
GAAAAKTHTGSLAGSFEVFKAAVRTVGGILVDNLHDMLNLAKLLMYSEPVTEELLVITNS
GGHGVLTSDEIEKNGLRMVEIPDWMKETLRKILPPTSVPRNPLDLTGDANKERYYSALKI
VSELNSTKLVIVQALPMVSCTDVARVISNFKGKGVIGITMGLDEDTALKILETTGIPAYT
FPEDAVKAIKYFVNKPIPRKKIRTVQPIESAIELVKGKKTLRDYEAMKLMEIYGIRTPKW
GIAESVEEAQRIADSIGYPVVMKISPDEPVHKTEMKGVVVNVEKDQVKDVYSQLSKITKR
VMIQEQLNGLEVYIGGIRDPVFGHVVLVGSGGIYVEVLKNVAYGLSPIYEDEAQELLMES
KIHAMLTARKRGYDENSLIRTIISVSRMIVDLNIREMDINPLFVNERGAFAVDVRIVFD
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgtcattagaatacctctttaaaccaaagagtattgctgttattggggcttctcgctat
aaagagaaagttggaaatgtggtattcagaaatcttctatatacttatcacggaaaactt
tacccagtaaattcaaaggctgaagatgttgaaggtgtaaaagcatataaaagcgttaag
gagattccagatcctatagatatggtagtaattacagtacctagagaggctgtgccacaa
gtaatggaagaggctgtagaaaaaaatgtgaaagcagcaattgtaattactgctggattt
aaagaagttggtgaggccgaattagaagataaggtcataagtattgccagaaaaggagga
ataagagttttaggaccaaatacatttggtatcattaccccagagtttaatgcaactttt
gcctatactgacgttaaaagaggaaatattgcattagttgttcaaagcggtggtctagga
gtttacatgctaaattgggcacagaaatatagagtaggaataagttatatggtgagttta
ggtaaccaagctgatgtaaaagagtatgaagttattgaatacctttcaagagacccagaa
acaagagcaatattcgtttacctagaaggagtctcagatggtaattctttcttagaaact
ttaccagaagccacgaagagaaaaccggtagtattcttaaaagggggtactacaagtaat
ggtgcagcagcagctaaaacacatactggcagtttggctggctcttttgaagttttcaaa
gcagcagttaggactgttggaggaattctggtggataatcttcatgacatgctaaaccta
gcaaagctcttaatgtattctgagccggttaccgaagaattacttgtaattactaattct
ggcggacatggagttcttacttctgatgaaattgagaaaaatgggttaagaatggttgaa
ataccagactggatgaaagaaactttaagaaagattttaccaccaacttcagtacctaga
aatcctttagatttaacaggagatgctaataaggaaagatactattctgcattaaagatt
gtcagtgagttaaattcgactaagttagttatagttcaagctttaccaatggttagctgt
acggacgttgctagagtgatttcaaactttaagggaaaaggagttatcggaattaccatg
ggacttgatgaggatactgcattaaaaattttagaaactactggaattccagcatataca
ttcccagaggatgctgtaaaagctattaaatattttgtaaataagccaataccgaggaag
aaaataaggacagttcaaccaattgaaagtgctatagaacttgttaagggaaagaaaaca
ttgagggattatgaggcgatgaaacttatggaaatttacggaataagaactcccaaatgg
ggaattgctgaaagtgtagaagaggcccagagaattgcagactctattggttatccagta
gttatgaaaatttcaccagatgaaccagtacataaaacagaaatgaaaggagttgttgtt
aatgtggagaaagaccaagtaaaggatgtttattcgcaattatctaaaataactaagagg
gtaatgattcaagagcagttaaacggtttagaagtctatattggtggtataagggatccg
gtatttggtcatgtagttctagtaggaagtggaggaatttatgttgaggttttaaagaat
gttgcatatggtttgtcaccaatctatgaagacgaagcacaagaactcttaatggagagc
aagattcacgctatgttaactgctaggaaaaggggttatgacgagaattcgcttataagg
acaataataagtgtctctaggatgatagttgatttaaatataagagaaatggacataaat
ccattatttgtaaatgagagaggagcctttgctgtagatgtaagaatagtatttgattaa

DBGET integrated database retrieval system