KEGG   Sulfurisphaera tokodaii: STK_16240
Entry
STK_16240         CDS       T00062                                 
Name
(GenBank) D-proline dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 NAD_binding_9 Pyr_redox MCRA NAD_binding_7 Thi4 HI0933_like FAD_binding_2 ApbA FAD_binding_3
Other DBs
NCBI-ProteinID: BAK54626
UniProt: F9VNI0
Position
1620781..1621899
AA seq 372 aa
MKVGIVGGGIVGLFTAYYLLKEEAEVTIFEKDFLGSGSIHAAGLIEPYRFDRINTTGMII
KMLRYISKRVTSVKSLNKAWVIELLKNLDKEPPTEAWETMKEMALFSLKEYRRLAEEKND
FDYEESGLLEIYSDEKELEKGIIEEKKSPFRPKFEIMEVKGFAGGIYFPELSKVDTHKFI
DRITKEIKDAKVVNVNVDKVSKDAKVYYSGKEEKFDKVVLSAGVWLRNVGLPITAFKGYG
YRVKGEMKVNFPSVLAELGVAVVKNSDFIKITGGFDGDFSSDSSRAEIFLNYAKSLVNIS
YVYDLYMGYRPCSPDGFPVIGKAENVVISTGACRLGWSYAPSMGNITTDLVLDRRNDVGY
LSRFIGGRNLSL
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttgaaagtcggaatcgtaggaggaggaattgtaggcttatttacagcctattatttgctg
aaagaggaagcagaagtcacaatatttgaaaaagatttcttaggtagcggatcaattcat
gccgctggtctaattgaaccatataggtttgatagaataaacactactggtatgattatt
aagatgcttagatacataagtaaaagagttacatcagtaaaaagtctaaacaaagcatgg
gtaatagagttacttaagaatctagataaagaaccaccaacagaagcttgggaaactatg
aaggaaatggctctattttccttaaaagaatataggaggttagctgaagaaaagaacgat
ttcgattatgaggaatctgggctgttagaaatttactctgatgaaaaggagctcgagaaa
ggaattattgaggagaaaaagagtccctttagacctaagtttgagattatggaggttaag
ggctttgccggtggtatttattttccagagctatcaaaagttgatactcacaaatttatt
gataggattacaaaggagattaaggatgcaaaagtagttaatgtgaacgtagataaagta
tctaaggatgcaaaagtgtattactctggaaaagaggagaaattcgataaagttgtttta
tctgctggagtatggttaaggaacgtaggtttacctataactgcatttaaaggttatggt
tatagagttaaaggcgaaatgaaagtaaatttcccttcagtcctagctgagttaggcgtt
gcagtagtaaaaaactctgactttattaagattactggtggttttgacggcgatttttct
tcagactcttctagggctgaaatatttctaaactatgctaaatctctagttaacataagt
tatgtttacgatttgtatatgggctatagaccttgctctcctgatggttttccagttatc
ggcaaagctgaaaacgttgtaatctctacgggtgcttgtagacttggttggagttatgct
ccatcaatggggaatataactactgatttagttttagatagaaggaacgacgttggttat
ctatctcgatttataggtggaagaaatttaagcctttaa

DBGET integrated database retrieval system