KEGG   Sulfurisphaera tokodaii: STK_16250
Entry
STK_16250         CDS       T00062                                 

Definition
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: DUF1955 Ca_bind_SSO6904 TPR_5 Bclx_interact
Other DBs
NCBI-ProteinID: BAB66704
UniProt: Q970G9
Structure
PDB: 
1WY6

Position
1621915..1622436
AA seq 173 aa
MTIVKSEIIRKLMDAKKFLLDGYIDEGVKIVLEITKSSTKSEYNWFICNLLESIDCRYMF
QVLDKIGSYFDLDKCQNLKSVVECGVINNTLNEHVNKALDILVIQGKRDKLEEIGREILK
NNEVSASILVAIANALRRVGDERDATTLLIEACKKGEKEACNAVNTLTVRSVM
NT seq 522 nt   +upstreamnt  +downstreamnt
atgactatagttaaatccgaaataattcgcaaactaatggatgctaagaaattcctttta
gacggatatatagatgaaggtgttaaaattgtccttgaaattactaaatcatctactaag
agtgaatacaattggttcatttgcaacttgcttgaaagcattgattgcagatacatgttc
caagtattggataaaataggaagttactttgacttagacaaatgccaaaacttaaagagc
gttgtagaatgcggtgtgataaacaatactttaaatgagcatgttaataaggcattagat
atattagtaattcaaggaaaacgcgataaactagaagaaataggaagagaaatactaaag
aataatgaagtaagtgcttctattttagttgctatagctaatgcattgagaagagtagga
gatgaaagagatgcaactaccctattgatagaggcgtgtaaaaagggagaaaaagaagcc
tgtaatgcagtaaacactcttacagtaagaagtgtcatgtaa

DBGET integrated database retrieval system