KEGG   Sulfurisphaera tokodaii: STK_16320
Entry
STK_16320         CDS       T00062                                 
Name
(GenBank) putative dUTP diphosphatase
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00240  Pyrimidine metabolism
sto01100  Metabolic pathways
sto01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    STK_16320
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     STK_16320
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: BAK54631
UniProt: F9VNI5
Structure
Position
1627716..1628195
AA seq 159 aa
MILSHQSIKNLLGKVILNYSEENVRENGYDLRICGDKYYELVQGAELPEKKATLREIEFK
ERAILSANHTYLFESCEEFNMPADLAVLITLKSTLARNGFLAPPTVIDAGYKGKVNVAIT
AVYNSSLKKGMATHHLIFLKLDKPTERLYNGKYQGGILI
NT seq 480 nt   +upstreamnt  +downstreamnt
atgattctctctcaccaatcaattaaaaatttactaggcaaagttattttaaattactct
gaggaaaatgtcagagaaaacggctatgatttaagaatctgtggagataaatattacgag
ctagttcaaggtgccgaattaccggaaaagaaggcaacattaagagaaatagaatttaaa
gaaagggctatcttaagcgcaaatcacacttatttatttgaatcttgtgaagaatttaat
atgccagcagacttagcagtactaataaccttaaaaagcacattagcaagaaacggtttt
ttggcacctccaacagtaattgatgctggctataaaggtaaagtgaacgttgcaattaca
gctgtatataactcctctctcaaaaaaggtatggcaacacaccatttaatattcctcaaa
cttgataaaccaacagaaagattgtataatggaaaatatcagggtggtatattgatttaa

DBGET integrated database retrieval system