KEGG   Sulfurisphaera tokodaii: STK_16590
Entry
STK_16590         CDS       T00062                                 
Name
(GenBank) 4-hydroxybutyryl-CoA dehydratase
  KO
K14534  4-hydroxybutyryl-CoA dehydratase / vinylacetyl-CoA-Delta-isomerase [EC:4.2.1.120 5.3.3.3]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00650  Butanoate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    STK_16590
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_16590
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.120  4-hydroxybutanoyl-CoA dehydratase
     STK_16590
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.3  vinylacetyl-CoA Delta-isomerase
     STK_16590
SSDB
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: BAB66740
UniProt: Q970D3
Position
1656186..1657694
AA seq 502 aa
MAIRTGEQYLDSIKIRNKAEIYVMGKEVKDVTTHPFLKPSVMAFKATFDAAWEEDTKELA
RAWSPFINEEVNRFNHIHRSPEDLAAKVKLLRKLSHKTGACFQRCVGWDALNTLWIMTNI
MAQKGKKEYKDRFVEYLSYVQKKDLALAGAMTDAKGVRTLKPHQQPNKNAYVRIEEVTKD
GIYVSGAKANITGVAATEEIVVLPTRAMGPEDKDYAVAFSIPTDTEGIKIIVGRQLNDAR
RLEGGDIDALPYFYNHEGLVIFDHVFVPMDRVFLMGEYEFTSQLVEVFSAYHRQGYGGCK
AGLGDVIIGASMNLAKQLGVEKASHVQEKLTEMIFLTETMYSAGIAASLNAVKVCDNCWW
VNPMHANVTKHLVARFPAQISQLSIDIAGGIIGTAPSEWDLKNPKLREYIAKYLQGVEGY
TAEDRLRMVRLLENVSLGVAFQIESVHGAGSPAAQRIMFSRLYDLNYAEEVAKRLAGKKT
DLQWKPKAEPWRESETEKLVKS
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaattagaactggagagcaatatttagattctataaaaattagaaataaggctgaa
atttacgtaatgggaaaagaagtaaaggatgtaaccactcatcccttcttgaaaccttct
gtaatggcatttaaggcaacatttgatgctgcttgggaagaggacacaaaagaattagcc
agagcatggagtcctttcataaatgaagaagtgaatagatttaatcacatacacaggtca
ccagaagacttagctgctaaagtgaaattactgagaaaattaagccataagaccggtgca
tgtttccaaagatgtgtaggatgggacgctctgaacactttgtggattatgacgaatata
atggctcaaaaaggtaaaaaagaatataaggatagatttgtcgaatacttaagttacgtc
caaaagaaggatttagcattagctggtgctatgacagatgcaaaaggtgtaagaacatta
aaaccgcatcaacaaccaaataagaacgcttatgttagaattgaggaagttaccaaagac
ggtatttatgtttctggtgcaaaggcaaatattactggtgtagctgcaacagaagaaatt
gtggttttacctactagggctatggggccagaagataaagattatgctgttgcattttca
ataccgacagatactgagggtataaaaattatagttggtagacaattaaatgatgctaga
agattagaaggtggtgacatagatgctttaccgtacttctataaccacgagggtttagta
atctttgaccatgtttttgtaccaatggatagagtattcttaatgggagaatacgagttt
acttcacaattagttgaagtattctcagcatatcatagacaaggatatggtggttgcaag
gctggtttaggagatgtaattattggtgcatcaatgaatttagcaaaacaattaggagta
gaaaaagcttcacatgtacaagaaaaactaacggaaatgatattcttaactgagaccatg
tattctgcaggaattgcagctagtttaaatgcagttaaggtctgcgataattgttggtgg
gttaatcctatgcacgctaatgttacaaaacatttagtagctagatttccagcccagatt
tctcagttatctatcgatattgcaggtggaataataggtactgcaccaagtgagtgggat
ctcaagaatcctaaattaagagaatatattgccaaatacttacaaggtgttgagggttat
acagctgaagatagattaagaatggttagattactggaaaacgttagtctgggtgttgca
ttccaaattgaatctgtacacggtgcaggaagtccagcagcacaaagaataatgtttagt
agactttatgacttaaactatgctgaggaagtcgcaaagaggttagctgggaagaagact
gatttacagtggaaacctaaagcagagccttggagagaaagtgagacagaaaaattagta
aaaagttaa

DBGET integrated database retrieval system