KEGG   Sulfurisphaera tokodaii: STK_17100
Entry
STK_17100         CDS       T00062                                 
Name
(GenBank) putative MarR family transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: MarR_2 HTH_27 MarR HTH_34 HTH_24 HxlR Fe_dep_repress TrmB HTH_1 HTH_5 DUF4423 HTH_47 Replic_Relax
Other DBs
NCBI-ProteinID: BAB66792
UniProt: Q96ZY1
Structure
Position
1711406..1711846
AA seq 146 aa
MLESNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRY
FVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTG
DLSEDEVILVLDKISKILKRIEEISQ
NT seq 441 nt   +upstreamnt  +downstreamnt
gtgttagaaagtaatgaaaacagaatacaaataatgtcaacaatagcaaaaatatacaga
gctatgagtagggaactcaatagaaggttaggagaacttaacttatcttatttagacttt
cttgttttaagggctacaagcgacggtccaaaaacaatggcatatttagcaaatagatat
ttcgttacacaatcagcaataacagcttctgttgacaaactagaagaaatgggtttagtt
gtaagagtaagggatagagaggatagaagaaagatactaatcgagattactgagaaagga
cttgagacatttaacaagggcatagaaatttacaaaaaattagctaatgaagttaccgga
gatctaagtgaagatgaagtaatattagttttagataagatttcaaagattttgaaaaga
attgaggaaattagtcagtga

DBGET integrated database retrieval system