KEGG   Sulfurisphaera tokodaii: STK_17750
Entry
STK_17750         CDS       T00062                                 
Symbol
fixC
Name
(GenBank) FixC protein
  KO
K00313  electron transfer flavoprotein-quinone oxidoreductase [EC:1.5.5.-]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_17750 (fixC)
SSDB
Motif
Pfam: DAO NAD_binding_8 HI0933_like Pyr_redox_2 Thi4 FAD_oxidored Pyr_redox GIDA FAD_binding_2 FAD_binding_3 Pyr_redox_3 Lycopene_cycl 3HCDH_N NAD_binding_9 ApbA
Other DBs
NCBI-ProteinID: BAB66865
UniProt: Q96ZQ9
Position
complement(1791618..1792772)
AA seq 384 aa
MKYDAIVIGAGPSGSASAYTLAKNGYKVLLIERGSEPGAKNVSGAMIRESEISKVFETKD
IPFERIVKRVRLIFRSKDDESEIVVKPKSKLYTVSRLKFDKWLAQRAESAGALLITKTTV
TGIEGNKVITERGSVEGDKIIIAEGANALLSMSLGLRRELKNEETVLGVKEVYASTRNEV
EKRFNLQGDEGESWRIITDYPLPSAGFIYTYKDSIAIGVGARVDEIITRGIRPFELLDSF
KMPYAELVKGFSLREYSAKIIPENGFPSFKPCEGAIYVAGDALGLIDPLTFDGIGPAIIS
GYLAGKAENCYSYSKTLFEAREISKVIKSRPLVKELLPNIGLYSHLINDFLTSWVEGDFS
KLRYYKSSLGKLMKHLILGLGVLE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaaatatgatgcaattgtaataggtgccggtccttccggttcagcatcagcttacact
ttagcaaaaaatgggtataaagtacttttaatagagagaggctcagagccaggggcaaaa
aatgtttcaggggcaatgataagggagtctgaaatttctaaagtctttgaaactaaggat
atcccatttgagagaatagtaaaaagagttagactaattttcagaagtaaagatgatgaa
agtgagattgtagttaaacccaagagtaagttatatacagtttcacgtttaaaatttgat
aaatggttagctcaaagggctgaaagtgcaggagcattattaattactaaaactactgta
actggaattgaaggtaataaggttataactgaaaggggaagtgtagaaggagataaaata
ataatagccgagggagctaacgctttactttcaatgtcattagggcttagaagagagtta
aagaatgaggaaactgtactaggagtgaaagaggtttatgcatctacaagaaatgaagtc
gagaagagatttaatttacaaggggatgaaggagaaagctggagaataataaccgattac
cctcttccctcagctggtttcatttatacttataaggactcaatagctataggagttggt
gctagggttgatgagattataactagaggtattagaccttttgaacttttagattcattt
aagatgccgtatgcggagttggtaaagggtttctcattaagggaatactcggcaaagata
attccagagaatggattcccatcatttaaaccttgtgaaggtgcaatttatgttgccggt
gatgcattaggattaattgatccattaacttttgacggtatcggaccagcaattatatct
ggttacttagccgggaaggctgagaattgttactcctactcaaaaacgcttttcgaagct
agagaaatatctaaggttataaaatcaagaccattagttaaggaattattaccaaacata
ggtctttactctcatcttattaacgatttcttaacaagctgggtcgaaggagatttttca
aagttaagatattataaaagtagtctaggtaagctcatgaaacatttaatcttaggttta
ggggtgttagaatga

DBGET integrated database retrieval system