KEGG   Sulfurisphaera tokodaii: STK_17770
Entry
STK_17770         CDS       T00062                                 
Name
(GenBank) putative transposase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: OrfB_Zn_ribbon HVO_2753_ZBP zf-C4_Topoisom zinc_ribbon_2 zf-ribbon_3 HMBD C1_2
Other DBs
NCBI-ProteinID: BAB66867
UniProt: Q96ZQ7
Position
complement(1794773..1795081)
AA seq 102 aa
MLNKLPSEFRDKLYLMQYRRVQYWVEWQAKKHGLLVVYVNPRYSSVSCPKCGKKMVEVSY
RWFKCICGYENDRDVIGIMNLNRRGSLTLSSAPQMRDVVPNR
NT seq 309 nt   +upstreamnt  +downstreamnt
atgcttaataaattaccatctgagtttagggataaactgtatcttatgcaatatcgtcgt
gttcagtattgggttgagtggcaggctaagaaacacggcttgttggttgtgtatgttaat
cctcgctattcttctgtctcttgtcctaagtgtggaaagaagatggttgaggtttcttat
cgttggtttaagtgtatttgtggttatgagaatgatagggatgttattggaattatgaat
cttaacaggagggggtctctgaccctctcgtctgcccctcaaatgagggatgtagtcccg
aaccgatga

DBGET integrated database retrieval system