KEGG   Sulfurisphaera tokodaii: STK_17810
Entry
STK_17810         CDS       T00062                                 
Name
(GenBank) indolepyruvate--methylviologen oxidoreductase subunit a
  KO
K18020  glyceraldehyde dehydrogenase large subunit [EC:1.2.99.8]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00030  Pentose phosphate pathway
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STK_17810
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With unknown physiological acceptors
    1.2.99.8  glyceraldehyde dehydrogenase (FAD-containing)
     STK_17810
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAK54660
UniProt: F9VNL4
Position
complement(1798339..1800573)
AA seq 744 aa
MRYVGQAVKRLYDDKFVTGKSTYVDDIQISALYAGFVRSPYSHAKIKSIDVTDALKVPGI
VAVYTYKDLAPLIKDGIRIWTTYEDPRMWKFVPRKPLADGKVRFAGEPVAIVIGVNKYVV
RDAIDKVNVDYEKLPPVVKMEEALEDKVIIHEELKTNVAFDQTFNGGNVEEAFKQADKVI
PVEITNNRLIPSPMEPRGIVSRYEGGTLTIWYSTQVPHLARSEFARIFGVPASKIRVIMP
DVGGAFGSKVNFMPEEVSVIASSIKLGRAVRWTATRSEEMLASEARHNTFKGEVAVKNDG
TVLGIRGDLLVDLGAYLTLTAPLQPAIIPLMVPGPYKIKGVSIRSRAVYTTTPPITMYRG
ASRPEATFIIERIMSIVADELKLDDVTIRERNLVRANEMPYTNPFGLKYDSGDYLALLKD
GIQKLQYYELKKWAEEERKKGRKVGVGMAYYLEISGFGPWEFGEIRVDENGDVLVITGGT
PHGQGTETAIAQVVADTLQIDISRIKVIWGDTETVVASMGTYGSRTAAAAASAAMVASKE
VLEKMKRIAAGLLNADVEEIEYESGEFYNKKDKSKKVSWNDVARNGYYGKELGISAQIIL
PGDVTFPYGVHVAVVEVDDYGIPRVLTYKAYDDIGNVINPALAEGQIHGGGVQAVGQALY
EEAIINEDGQLTVTYADYFIPTAVEAPKFESYFVEKPHTSTWPTGAKGVGEAALIVGPAV
IIRALEDATGKRFTKTPVRPEEIL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgaggtatgttggtcaagcagttaaaagactttatgatgataagttcgtaaccggaaaa
agtacctatgtggatgatattcaaatatcagcactatatgccggatttgtaagaagtccc
tattcacatgctaaaataaagagtattgatgttacagacgcgttaaaagtccccggtata
gttgctgtatacacttacaaggatttagcaccgttaataaaagacggtataagaatttgg
accacatatgaagatccgaggatgtggaagtttgttcccagaaagccattagcagatggt
aaagttagatttgccggtgagcctgtagcaatagttattggtgtaaataaatatgttgtt
agagatgctattgataaagtgaacgttgattatgagaaattaccgccagtagtaaaaatg
gaagaggctttagaagataaagtaataatccacgaagagttaaaaactaatgtagccttt
gatcaaacctttaatggtggaaatgtagaagaagcttttaagcaagcagataaagttatc
ccagttgaaataaccaataatagattaattccatcaccaatggaaccgagaggtatagtt
tcacgctatgaaggcggaacgttaacaatatggtattctactcaagttcctcatttagct
aggagtgaatttgcgagaatatttggagttccagctagtaaaataagagtaataatgcca
gatgttggcggagcttttggaagcaaagttaactttatgccagaagaagttagcgttata
gcatcctcaataaagttaggaagagctgtaagatggacagctaccagaagcgaggaaatg
ttagcatcagaggccagacataatacgtttaagggagaagtagcagtaaagaatgacggt
acggtattaggtataaggggagacttactagttgatttaggtgcttatttaacgcttact
gcaccattacaacctgcaataatcccactaatggtacctggaccttataagattaaaggc
gttagtataagaagtagggctgtttatactactacaccaccaattacgatgtataggggt
gcgagtagaccagaggcaacatttatcatagagagaattatgagtattgtagccgatgaa
ttaaagttagacgacgtaactattagagagaggaatttggtaagggcaaatgaaatgcca
tatacaaatccctttgggctgaaatacgattctggtgattacttggctttactaaaggat
ggaatacagaaacttcaatactatgaattaaagaagtgggctgaagaagagagaaagaag
ggaagaaaagtaggagttggtatggcgtattacctggaaattagtggttttggtccttgg
gaatttggagaaatcagagtcgatgaaaacggtgatgtattagttatcactggaggaact
cctcacggtcaaggaacagaaacggcaatagcacaagtagttgcagatactttacaaata
gacattagtagaataaaggtaatatggggagatacagaaacagtagtagcaagtatggga
acttatggttcaagaacagctgctgctgcagctagtgcggctatggttgcttcaaaggaa
gtattagaaaaaatgaagagaattgctgctgggttattaaatgcagatgtagaagaaatt
gagtatgaaagtggagaattctataataagaaagataagagtaaaaaagtaagttggaat
gatgtagctagaaacggttattatggtaaagagttgggaatatcagcccaaataatctta
cctggtgatgttacattcccgtatggtgttcatgtagcggttgttgaagtcgatgactat
ggtattcctagagtattaacatacaaagcatatgatgatataggtaatgtaataaatccg
gcgttagctgaaggtcaaatacacgggggtggcgtgcaagctgttggacaagcattatat
gaagaggctatcattaacgaagatggacaactcactgttacttatgctgattactttata
ccgacagctgttgaagcaccaaagttcgagagctacttcgttgaaaaacctcacacatca
acatggcctacaggtgctaaaggagtaggtgaagccgcattaatagttggaccagcagta
attatcagagcattagaggatgcaacagggaagaggtttacaaagacacccgttagacct
gaagagatattatga

DBGET integrated database retrieval system