KEGG   Sulfurisphaera tokodaii: STK_17870
Entry
STK_17870         CDS       T00062                                 
Name
(GenBank) 2-oxoacid--ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00020  Citrate cycle (TCA cycle)
sto00620  Pyruvate metabolism
sto00640  Propanoate metabolism
sto00650  Butanoate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01210  2-Oxocarboxylic acid metabolism
Module
sto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_17870
   00020 Citrate cycle (TCA cycle)
    STK_17870
   00620 Pyruvate metabolism
    STK_17870
   00640 Propanoate metabolism
    STK_17870
   00650 Butanoate metabolism
    STK_17870
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_17870
   00680 Methane metabolism
    STK_17870
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    STK_17870
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     STK_17870
SSDB
Motif
Pfam: TPP_enzyme_C E1_dh DXP_synthase_N
Other DBs
NCBI-ProteinID: BAK54666
UniProt: F9VNM0
Position
complement(1804301..1805206)
AA seq 301 aa
MSLGVRDILNKPRLLPGTSACPGCPENIALKSISMALGENAVFIVVAGCSSIIQGMGPKS
TYNYPVLNIAFAAGPAAAAGMAKAFKMRNKNIKPVVWAGDGGTADIGFASLSGAAERNDN
ILYICVDNEAYMNTGGHRSGSTPFGAKTASTPGGKKENKKDLPLIMMAHHIPYVATASVG
YLHDLMEKVKKARSIEGFTYIQVLTPDPYGWMFDPSKTAEVGKLAVQTCYWPLIEYENGK
LTISQESMHCLDRRTRKPIDEFLKIQGRYKGVSPEIVKGLEEYIDRMWERIKSIYEGKVI
L
NT seq 906 nt   +upstreamnt  +downstreamnt
ttgagcttaggagtccgagatatattaaataaaccccgattattacccggtacttcagct
tgtccaggttgtccagagaatatagcattaaaatcaataagtatggctctaggagaaaat
gctgtgtttatcgttgttgctggttgttcttcgataattcaaggtatgggtccaaaatca
acttataattacccagtattgaatatagcttttgcagctggcccagcagcagctgctgga
atggctaaagcatttaagatgaggaacaaaaacattaaaccagttgtatgggcaggagat
ggtggtactgcagatataggttttgcttcattaagcggtgctgctgaaagaaatgataac
attctttacatctgcgttgataatgaggcttacatgaatactggggggcatagaagtggt
tccacaccatttggggctaaaacagcttcaacgcctggtggtaaaaaagaaaataaaaaa
gacttaccgcttattatgatggctcatcacattccttatgttgctacggctagtgtaggc
tatctacacgatttaatggaaaaggttaaaaaggctagaagtattgaaggttttacgtat
attcaagttttaactccagatccttatggttggatgtttgacccttctaaaacagctgaa
gtagggaaattagcagttcaaacatgttattggccattaatagaatatgagaatggtaaa
ttaactatttctcaagagagtatgcattgtctcgacagaaggacgagaaaaccaatcgac
gagttcttaaagatacaaggtagatataagggggtttcaccagaaattgtgaaaggtctt
gaagaatatatagatagaatgtgggaaagaataaagagtatatatgagggtaaggttata
ttatga

DBGET integrated database retrieval system