KEGG   Sulfurisphaera tokodaii: STK_17900
Entry
STK_17900         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: 4HBT 4HBT_3
Other DBs
NCBI-ProteinID: BAB66881
UniProt: Q96ZP3
Position
complement(1808739..1809140)
AA seq 133 aa
MITEDEVNKLLSENEALFRFMGAKFEKIERGVAKLSFEYKEELSRIGGMLHGAIIFAAMD
YSGSYAVRTLDVKEAYTLEFNVIFLKAMKTPPFTFLARVVRETKRYAYVEVEGFDGNNEL
CAKGNGIWHLIRD
NT seq 402 nt   +upstreamnt  +downstreamnt
atgataactgaagatgaggtaaataaacttcttagtgagaatgaagctctctttaggttt
atgggtgctaagtttgaaaaaattgagagaggtgtggctaaactttcctttgaatataaa
gaggagttaagtagaattggaggaatgcttcatggtgctatcatatttgccgctatggat
tactctggtagttatgctgtaagaactcttgacgtaaaggaggcttatactttagagttt
aatgtaatatttctaaaggcaatgaaaacaccaccattcacatttctagctagggttgta
agagaaactaaaagatatgcgtatgttgaagttgagggttttgacggtaataatgagtta
tgtgcaaaaggaaatgggatttggcatttaatcagagactaa

DBGET integrated database retrieval system