KEGG   Sulfurisphaera tokodaii: STK_18030
Entry
STK_18030         CDS       T00062                                 
Name
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00620  Pyruvate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00640  Propanoate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_18030
   00620 Pyruvate metabolism
    STK_18030
   00630 Glyoxylate and dicarboxylate metabolism
    STK_18030
   00640 Propanoate metabolism
    STK_18030
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_18030
   00680 Methane metabolism
    STK_18030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sto01004]
    STK_18030
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STK_18030
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STK_18030
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-ProteinID: BAB66895
UniProt: Q96ZM9
Position
1820756..1822621
AA seq 621 aa
MEAEFYSLQKIRKLSEEAVKDPESFWKDKMHLISWFKEPEKIREGEPPFEKWFVNGYTNI
SYNAIDRHLDKSEKVAFYWINEKLDTRSITYRDLYCEVNRASYVLKELGVKKGDVVSLIM
PSIPEAVYMSLAVHRLGATLVIHYLGLSEETLTYRLNDCNSRVLIVASKGFRNGNEIRIK
DFVDKLLDSRKTPIEKVLVVKRGYDDFNVTKRDVIYEEVRPRGRVYVEPIWVESNEPSTI
YYTSGTTGRPKGLYHSTAGYVIALNYAFKSLMGPKENDIWWTISELGWPVWPMANLYTIP
FMGLTGVLFEGYIGYKPDMFSRIIERFGVNLVWSSTTTLYTLKSLGEESVKSGDTSTLRL
ILNTGEPLNPGAWKWLRENMPHVTIADAYWMTEHLFPVAGTPFGIGEIPYKAGSAGIRFP
GSDFRVVDDDGKELQVGKKGYIVLKPISPALAKMHNDTNGERIIKTYWSRFPGYFYTGDY
GYMDEDGYLYVLGRADDVIKSGERIGTLEVESVVVTHPAVAEAAVVGYPKEVGEGILVLA
VIKKGYPMSEDLANDIKSYLRNSGYIVDKVYLVRRLPKTKSGKIMRRLIRALVRNEEIGD
ISTLDDPSILEELKSILSEKD
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggaagcggaattttatagtttacaaaaaattagaaaattaagtgaggaagcagtaaaa
gacccagaaagtttttggaaggataaaatgcatttgatctcatggtttaaagagccagaa
aaaataagggaaggagaaccaccatttgagaaatggtttgttaatggttatactaatatt
tcttataacgcaattgatagacatttagataaatctgaaaaagtagctttctattggata
aatgagaaattagatactaggagtataacttatagagatttatattgtgaggtaaatagg
gcttcttacgttttaaaagaactaggagtaaagaaaggtgacgtagtatctcttataatg
cctagtattccagaggcagtctatatgtctttagctgtacataggctaggggcgacacta
gtaatacactatctaggtttaagtgaggagacattaacttataggctaaatgattgtaat
tctagggttttaatagttgctagcaagggtttcagaaacggaaatgaaataaggataaaa
gatttcgtggataagcttcttgattccagaaaaactccgatagagaaagttttagtagtg
aaaagaggttatgacgattttaacgttacaaagagggacgttatatatgaagaagtaaga
cctaggggtagagtttatgttgaaccaatctgggtagaatctaatgagccttcaacaatt
tattatacttctggaaccactggtagacctaaaggcttatatcactctacagcaggatat
gtaatagcattaaattatgcctttaaatcccttatgggtcctaaagagaatgatatatgg
tggacaatatctgaattaggctggccagtatggcctatggcaaatctttacacaatacca
ttcatgggtcttactggagtactttttgagggatatataggatataaaccagatatgttc
tccagaataattgaaaggtttggagttaatttagtatggagttcaacaacaactttatat
acattaaagagccttggagaagaatcggttaaatctggagatacttcaacactgagactc
attttgaacactggagaaccattaaaccctggtgcatggaaatggttaagagaaaatatg
cctcacgttactattgcagatgcgtattggatgactgaacatttattcccagttgctgga
acaccttttggaataggagagattccttacaaagcggggtctgctggaattagatttcct
ggtagtgattttagagtagtggacgatgacgggaaagaattacaagttggaaagaaggga
tatattgtgttaaagcctattagcccagctttagcaaaaatgcacaatgatactaacggg
gaaaggattataaagacctactggtcgaggttccctggatatttttacactggtgattac
ggctatatggacgaggatggatacctttacgttttaggaagagctgatgatgtaataaag
tctggtgaaagaataggtactttagaggtagaaagtgtagttgtaacacatccagcagtc
gctgaggctgctgtagtaggctacccaaaggaagtaggagaaggaattttagttttagct
gtgattaagaaaggttatccaatgagtgaggatttagctaatgatataaaatcatatcta
agaaatagtggatatatagtagataaagtatatttagtaagaagactaccaaagactaag
agtggcaagataatgaggagattaataagagcactggtaaggaatgaggagattggtgat
atctctactttagatgacccaagcatattagaggagttaaagagtatattaagtgagaaa
gattga

DBGET integrated database retrieval system