KEGG   Sulfurisphaera tokodaii: STK_18080
Entry
STK_18080         CDS       T00062                                 
Symbol
prpB
Name
(GenBank) 2-methylisocitrate lyase
  KO
K03417  methylisocitrate lyase [EC:4.1.3.30]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00640  Propanoate metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    STK_18080 (prpB)
Enzymes [BR:sto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.30  methylisocitrate lyase
     STK_18080 (prpB)
SSDB
Motif
Pfam: PEP_mutase ICL ComA T2SSE IMPDH
Other DBs
NCBI-ProteinID: BAK54672
UniProt: F9VNM6
Position
complement(1825039..1825881)
AA seq 280 aa
MSEILRKSDFLIIPGVFNPFTALLAEKVGFKAVYLSGGALTSSYGLPDLGIITLDEVAEM
VRRIREVTDIPIIVDADTGFGEVINVYRAVKVLEKAGANAIQIEDQVLPKKCGHLEGKEV
VSSKDMVAKIKSALKARKDMLIIARTDARAVNGLEDAIERAKMYLEAGADIIFPEALESK
EEFAKFAKEVKAPLLANMTEFGKTPLITANEFKEMGYKYVIFPVTIFRVAAKAMKEALEV
LLKEGSQKSLMDKMMTRKEQYEIINYYFYENLDKQLAKDL
NT seq 843 nt   +upstreamnt  +downstreamnt
ttgtcagaaatcttgcgaaagtctgatttcctaattattccgggcgtatttaatcctttt
acagcattactagctgaaaaagtaggatttaaagcagtgtatctgtctggaggagcttta
acgtcctcatacggcttaccagatcttggcataataacgttagatgaagtagcagaaatg
gtcagaagaattagggaagtcactgatattccaattattgttgatgctgatactggcttt
ggagaagttataaatgtatatagggctgtgaaagttttggaaaaagctggtgccaatgct
attcaaattgaggatcaagttcttccaaagaaatgtggtcatctagaaggtaaagaagtt
gtgagttctaaagatatggttgctaaaataaaatcagcactaaaggccagaaaagatatg
ttaataattgctagaactgacgcaagagcggtaaatggtcttgaagacgctattgagaga
gctaagatgtatttagaagctggtgctgatataatttttccagaagcattggaaagcaaa
gaagaattcgccaaatttgctaaagaagttaaagcaccactattggctaatatgacagag
tttggtaaaacgccgttaataactgctaatgagtttaaagaaatggggtataagtacgtt
atctttccagtgactattttcagagttgcagcaaaagccatgaaagaagcgttagaggta
cttcttaaagaaggatctcaaaaatcattgatggataagatgatgactaggaaggagcag
tatgaaattatcaattattacttttatgagaatttagataagcaacttgcgaaagattta
tag

DBGET integrated database retrieval system