KEGG   Sulfurisphaera tokodaii: STK_18110
Entry
STK_18110         CDS       T00062                                 
Symbol
mdh
Name
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00020  Citrate cycle (TCA cycle)
sto00270  Cysteine and methionine metabolism
sto00620  Pyruvate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00680  Methane metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sto_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STK_18110 (mdh)
   00620 Pyruvate metabolism
    STK_18110 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    STK_18110 (mdh)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_18110 (mdh)
   00680 Methane metabolism
    STK_18110 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STK_18110 (mdh)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     STK_18110 (mdh)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored NAD_binding_2 OCD_Mu_crystall Epimerase_2 3HCDH_N NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: BAB66902
UniProt: P58407
Position
1827233..1828159
AA seq 308 aa
MTKIAFIGVGKIGQTIAFNTIMDGYADEVMIYDIIPELPEKFEHELRHALASKRLKVELL
STNNLDDVAGADIVVITAGKPRKPGMSRRDLFVDNAKIMMDLANKLPKKNHGAVYIMVSN
PVDMMASVFARYSREFVISTGDQVETMRLRAYIAKKLKIPVYRVNGFVGGEHGEDAVVLW
STVTVNGKPFSEDLGVTKAEVEDYVKKIPGEIIRVMGGTTWGPGTIIAELIRAVALNENK
VMSIATPRQFEDEIIHVSVPTVVGSSIGPSLENLLDEKDRWNLMASMKDFYNVYKENLKH
LETSIQAQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atgacaaagatagcttttataggagttggaaagataggtcagacaatcgcctttaatact
ataatggacggttacgctgatgaggtcatgatctacgatattatcccagaattaccggag
aaatttgaacatgaacttagacatgctcttgcatctaaaagacttaaagttgaactttta
tctacaaacaacttagacgatgttgctggtgctgatattgtagttattactgctggtaaa
ccaagaaaacctggtatgagtagaagagatctgtttgtagataatgctaaaataatgatg
gatctagctaacaaattacctaagaagaatcatggagccgtttatattatggtttccaac
ccggtagacatgatggcttctgtattcgcaagatattctagggaattcgtaattagtact
ggagaccaagtagagacaatgaggttaagagcatatatagctaaaaaactaaagatacca
gtttatagagttaatgggtttgtaggtggagagcatggtgaagatgctgtagtattatgg
agtactgtaacagttaatggaaaaccattctcagaggatttaggagttacaaaggcagag
gttgaagattatgtaaagaagatcccaggagagataattagagttatgggaggtactaca
tggggtcctgggactattatagctgaattaataagagcagtagcactcaatgagaataaa
gttatgtcaatagctactccaagacaatttgaagacgaaataattcacgttagtgtgcca
acagtagttggaagttcaattggtccttcattagaaaacttattagatgaaaaggacaga
tggaatttaatggcttcaatgaaagacttctataatgtatataaagagaatttgaaacac
ctagaaacttctatccaagcacagtaa

DBGET integrated database retrieval system