KEGG   Sulfurisphaera tokodaii: STK_18210
Entry
STK_18210         CDS       T00062                                 

Gene name
cbiD
Definition
(GenBank) putative cobalt-precorrin 6A synthase
  KO
K02188  cobalt-precorrin-5B (C1)-methyltransferase [EC:2.1.1.195]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00860  Porphyrin and chlorophyll metabolism
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STK_18210 (cbiD)
Enzymes [BR:sto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.195  cobalt-precorrin-5B (C1)-methyltransferase
     STK_18210 (cbiD)
SSDB
Motif
Pfam: CbiD
Other DBs
NCBI-ProteinID: BAK54676
UniProt: Q96ZL3
Position
complement(1834447..1835499)
AA seq 350 aa
MLSTLKRFGITTGATAAASAKASVIYLFRNETPKSVTIPTPIGLRLEIPVDDYERRGEEY
CATVTKFSGDNPDVLNGLKIVSCSTKCDSGIFIEGGNGIGVVTKPGLKVEVGEKAINPIA
RQMIIDAINEVTTDGVKVRIEVPDGEKIAELTMNKDVGVINGISILGTTGIEYPISDDEY
LEHIKSEICVVKALGKKKLILAPGNTSFEFARKRYGDNVVKIGDRVGDSIRLAIEQGFTH
IVLVSLPGKITKVASGLMNTHSKYGDARIETLTHAAVLAKLDIEKINKIANSATVTEAIT
YLLPEERKTLFSIVAKRVLQRLRKIVKNDVKLGVVIISEEGEVLAEEGEL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgctttcaactcttaaaagatttggaataacaaccggggctactgcagcggcatcagca
aaggcctctgttatctatttatttcgtaatgaaactcctaaaagtgttacaattccaact
ccaattggtttaagactagaaattccggtagatgactatgaaagaagaggagaagaatac
tgtgctacagttacaaaattttctggggacaacccagatgtattaaatggattaaagatt
gttagctgtagtacaaagtgtgattccggaattttcatagaaggaggaaatgggataggt
gtagttactaaaccaggacttaaagtagaagtgggtgaaaaagcgataaatccaatagca
agacaaatgataatagatgctataaatgaagtaaccactgatggtgtaaaggttaggatc
gaagttccagatggtgaaaaaatagccgaacttacaatgaataaggacgttggagttatt
aacggtatttcaattttaggaactactggtattgagtatcctatcagtgatgatgaatat
cttgagcacataaaaagtgagatatgcgttgttaaggctttagggaagaagaagttaatc
ttagcaccaggtaatactagctttgagtttgccaggaaacgttatggcgataatgtagta
aagataggagatagagtaggtgattcaataaggttagcaattgagcaaggttttactcat
atagttttagtcagcttacctgggaaaataactaaagttgcatctggtttaatgaacacc
catagtaaatatggtgatgcaagaatagaaaccttaactcacgcagcagttctagcgaaa
ttagacattgaaaagataaataagatagctaactctgctactgtgacagaagcaattaca
taccttttaccagaggaaagaaagacactcttcagcatagtagctaaaagagttcttcag
aggttaaggaagattgtgaaaaatgatgtgaaattaggtgtagttattatttctgaagaa
ggagaagttttagctgaggagggtgagttatga

DBGET integrated database retrieval system