KEGG   Sulfurisphaera tokodaii: STK_18390
Entry
STK_18390         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Fer4_11 Fer4_7 Fer4_10 Fer4_2 Fer4_8 Fer4_9 Fer4_3 Fer4_6 Fer4_17 Fer4_4 Fer4 Fer4_21
Other DBs
NCBI-ProteinID: BAB66929
UniProt: Q96ZJ6
Position
complement(1848032..1848844)
AA seq 270 aa
MSSITLNPKEGGIQKSLPFTPKKNYAIITDLNKCFGCAGCQMSCKEWNTSGMFGPLPDLN
PYGELDVMFWLRVLYVEVGNYPQTKVYNIPINCFHCMNAPCVPVCPVGATFKREEDGIVL
VDYNECIGTKYCIYACPYGNRFFDYVEGVTKKCTHCFDRIYDPTLPPEERIPACIHGCMV
QARIWADRLDPTDPGNILFIDKGGFVLGPETGADPASGYLPWRSAYAADNDVELLSESEY
YNVWTSNGVVILGSQGNNSTYTEQNGNSTS
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtcctctataactctaaatccgaaagaaggtggaattcaaaaatcccttcctttcacg
ccaaagaaaaactatgctataataactgacttaaacaagtgtttcggctgtgctggctgt
caaatgtcatgtaaagaatggaacacctctggaatgtttggaccgttaccagatctaaat
ccatatggagaattagatgttatgttctggctaagagtgctttatgttgaagttggtaac
tatccgcaaactaaagtttacaacatcccaataaactgtttccactgtatgaatgcccct
tgtgtaccagtatgtccagttggtgctacgtttaagagagaagaagacggaatagtatta
gtagattataatgagtgcataggaactaaatactgtatttatgcatgtccttacggtaat
agattcttcgattatgttgaaggtgttacaaagaagtgtactcattgttttgatagaatt
tatgatccaacactaccgccagaagaaagaatcccagcttgtatacacggctgcatggtt
caagcgagaatatgggctgatagattagatcccactgaccctggtaatatactgtttata
gataaaggtggatttgttttaggtccagaaaccggtgctgatccagctagcggttattta
ccgtggcgtagtgcatacgccgctgataacgatgttgaattacttagcgagtcagaatat
tataacgtatggacttcaaatggtgtagttattttaggatctcaaggaaataactctacc
tacacagaacaaaacggtaattctacaagttaa

DBGET integrated database retrieval system