KEGG   Sulfurisphaera tokodaii: STK_18650
Entry
STK_18650         CDS       T00062                                 
Symbol
lpdA
Name
(GenBank) putative dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoyl dehydrogenase [EC:1.8.1.4]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00020  Citrate cycle (TCA cycle)
sto00260  Glycine, serine and threonine metabolism
sto00280  Valine, leucine and isoleucine degradation
sto00310  Lysine degradation
sto00380  Tryptophan metabolism
sto00620  Pyruvate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00640  Propanoate metabolism
sto00785  Lipoic acid metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01210  2-Oxocarboxylic acid metabolism
sto01240  Biosynthesis of cofactors
Module
sto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sto_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
sto_M00621  Glycine cleavage system
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_18650 (lpdA)
   00020 Citrate cycle (TCA cycle)
    STK_18650 (lpdA)
   00620 Pyruvate metabolism
    STK_18650 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    STK_18650 (lpdA)
   00640 Propanoate metabolism
    STK_18650 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_18650 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    STK_18650 (lpdA)
   00310 Lysine degradation
    STK_18650 (lpdA)
   00380 Tryptophan metabolism
    STK_18650 (lpdA)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    STK_18650 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_18650 (lpdA)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     STK_18650 (lpdA)
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   STK_18650 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim GIDA NAD_binding_8 Pyr_redox_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C DAO FAD_binding_3 Thi4
Other DBs
NCBI-ProteinID: BAB66956
UniProt: Q96ZG9
Position
1877227..1878465
AA seq 412 aa
MIVVIGSGPAGIYGAFTASALGEKVKLIEEKERLGGTCVLYGCIPSKAMLHPLYLKYSLE
RLGKKIDFSYEELIKLAQDAISRISKGVEYMLESYGVEVIYGRGVLKSKEIEVSGQTLYP
DKVLVATGTLKPEINGTIASDDLPYLNKEFNSVTVIGGGVGGIEYGWLLHKIGKEVHIVE
KENLLLPKHDMDLRNYVTNHFKRIGVKLHLGVEAKIENNKVKLSNGEEIKSDIILMSFGR
KPNLTGVESLPHDYWIKVNEYMETPIKDIYAAGDITGSFTAHEAIHKGYIAGLNMKGIKK
PYDSSAVPKVIYTSPQIAYVGNTNSGRCMKMEFSGLARAIAEKETEGFLKICVENEKVIG
GVAFSERAEEIISLLALGIKFKGSLDELLDFQYPHPSYLEMIWEILRKIKWG
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgattgttgttataggctctggtcctgccggaatatatggtgcatttacagcttctgct
ttaggagaaaaagttaagcttatcgaggaaaaagaaaggttaggtggaacttgtgtttta
tatggttgtattccttcaaaagcaatgttacatccactttatttaaagtattctttggaa
aggttgggaaagaaaatcgattttagctatgaagaactgatcaagcttgcccaagatgcg
atttcaaggatctcaaaaggagttgaatacatgttagaaagttacggtgttgaagtcatt
tatggtagaggagtacttaaaagcaaagaaattgaagtttctggtcaaactttataccca
gataaagtactagtagcaactggaactttaaaaccagaaattaatggaactatagcttca
gacgatttgccgtatcttaataaagagtttaattcagtaaccgtaattggtggtggtgta
gggggtattgaatatggctggttgttacacaaaatagggaaagaagtacatatagtagag
aaagaaaatttacttttaccgaaacatgatatggatttaagaaattacgtaactaaccac
tttaagagaattggagttaaacttcatttaggagtggaggctaagatagagaataataaa
gttaaactctcgaatggagaagaaattaagagcgatattattttaatgagttttggaaga
aaacctaatcttactggggttgaaagtctacctcatgattattggataaaggttaacgag
tacatggaaactccgataaaagacatttacgctgctggtgatataactggttcatttaca
gcacatgaagcaatacataaaggatatatagctgggcttaatatgaaaggaatcaaaaaa
ccttatgatagttctgctgttccaaaggttatttatacatcaccacaaattgcttacgtc
ggaaacacaaatagtggtagatgtatgaaaatggaattttctgggttagctagagctatt
gcagaaaaggagactgaaggatttttaaagatctgtgtggaaaatgaaaaagtaataggt
ggtgttgcattttcagaaagggctgaagaaattatctctcttttggctttagggattaag
tttaagggaagtttagatgagcttctcgatttccagtatccacatccttcttatcttgaa
atgatatgggaaattttaagaaaaattaagtggggataa

DBGET integrated database retrieval system