KEGG   Sulfurisphaera tokodaii: STK_18670
Entry
STK_18670         CDS       T00062                                 
Symbol
lrs14
Name
(GenBank) transcriptional regulator Lrs14
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TrmB MarR_2 MarR HTH_24 TFIIE_alpha Mga HTH_36 Fe_dep_repress HTH_5 HTH_34 DUF2250 HTH_29 HTH_IclR DUF4423 GntR HTH_11 HTH_27 HTH_Crp_2
Other DBs
NCBI-ProteinID: BAB66958
UniProt: Q96ZG7
Position
complement(1879441..1879824)
AA seq 127 aa
MELEVTKIRLTSGKEVGIIEALSFCYDISDTDFQVLKVLLNSEGKNEDSLAEMLKLSKAS
INRSVNKLVSLGFVERVKDSSSKGGRPRYIYKAIPTERLIEKIVNDFKRCAELFGQLIPK
ELGKQQQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atggaattagaagtaactaaaataagactaactagtggtaaagaagtaggaataatagag
gctttaagtttttgctatgatatttcagatacagattttcaagtactaaaagttttatta
aacagtgaaggaaagaatgaagattctttagcagaaatgctaaaattatctaaagcctct
atcaacagaagtgtaaataaattagtatctttaggttttgttgaaagagtaaaagattct
tcttctaaaggaggtagacctagatatatctataaggctataccaactgagagattaata
gagaaaatagttaatgatttcaagagatgtgccgagctcttcggacaattaattcctaag
gagttagggaaacaacaacaataa

DBGET integrated database retrieval system