KEGG   Sulfurisphaera tokodaii: STK_18730
Entry
STK_18730         CDS       T00062                                 
Name
(GenBank) hypothetical protein
  KO
K03388  heterodisulfide reductase subunit A2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00680  Methane metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    STK_18730
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     STK_18730
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     STK_18730
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     STK_18730
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     STK_18730
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_3 HI0933_like FAD_oxidored FAD_binding_2 DAO Pyr_redox_3 Amino_oxidase GIDA Pyr_redox NAD_binding_8 Thi4 NAD_binding_9 Lycopene_cycl AlaDh_PNT_C IlvN NAD_binding_7 Shikimate_DH Lys_Orn_oxgnase
Other DBs
NCBI-ProteinID: BAB66964
UniProt: Q96ZG1
Position
complement(1884403..1885500)
AA seq 365 aa
MAGEKVLVIGAGPAGLSATKELANLGVNVVLVEREAFLGGTPKRLKYSLLFPELRPASEV
IDPLIKSVQENKNVKIYLESIVDSVKQEGNGFTVNIKDKSGKITTEKVNAIIAASGFEHF
DSRRKYEYGYGIIPNIYQISDIEGMLSENRLVTTKGTPPKRVAILLCVGSRDATVGNTYC
SRVCCAVSIKQAMEIKQRIPDAVVHIYYMDIRTYGLMEDKLYWKAQLDYRVGFIRGRISE
FMRGPNDTVIIKGEDTMNLNRALVVPYDMVILANGMELGLGSKQVAKVLGLEFESHGFVK
PLDPDRLPVQSTKKGIFLAGAITGPKTISDSITEGYAAAMKAYEYIMKGTWEEPVKVATA
EVAHH
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggctggtgaaaaagttctcgtaattggagctgggcccgctggattatctgctacaaag
gaattggctaatttaggtgttaacgtagttttagtagagagagaagcttttcttggtggt
actccaaaaagattgaaatatagcctattattcccagaattaaggcctgcctcagaagta
attgatcctctaattaaatcagtccaggaaaataaaaatgttaaaatttacctagaaagt
atagttgatagtgtaaaacaagagggtaatggatttactgtgaatattaaggataagagc
ggaaaaattactacagaaaaagtaaatgcaattatagctgcttcaggttttgaacatttt
gattctaggagaaaatatgagtatggttatgggataataccaaacatttatcaaatctct
gatattgaaggtatgctttcagaaaatagattagtaactacaaagggtacaccaccaaaa
agagttgcaatcttattatgtgttggttcaagagacgccactgtaggaaatacttattgt
tcaagagtctgttgtgccgtatcaattaagcaagcaatggaaattaagcaaaggattcca
gatgcggttgttcatatttactatatggatataagaacttatggattaatggaggataaa
ctatactggaaagcacaattagactacagagtgggattcataagaggaagaatttcagaa
ttcatgagaggccccaatgacacggtgataattaaaggagaagatacaatgaacttgaat
agagcattagtagttccatatgatatggtaatattagctaacggtatggaactaggttta
ggttcaaaacaagtagctaaagttttaggactagagtttgaaagccacggatttgtcaaa
ccattagatccagataggttaccagttcaatcaactaagaaaggaatattcctagctggt
gcaataactggtcctaagacaatatcagactcaataacagaaggatatgctgctgcaatg
aaggcttatgagtatattatgaagggcacatgggaggaaccagtaaaggtagctactgct
gaggtggctcatcattaa

DBGET integrated database retrieval system