KEGG   Sulfurisphaera tokodaii: STK_18890
Entry
STK_18890         CDS       T00062                                 
Symbol
sto12a
Name
(GenBank) DNA-binding protein Sto12a
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TrmB MarR_2 HTH_5 HTH_11 GntR MarR HTH_20 HTH_27 HTH_Crp_2 HTH_24 HTH_DeoR TFIIE_alpha HTH_36 Rrf2 Fe_dep_repress SMC_ScpB PadR DUF4423 HTH_IclR Phage_rep_O HrcA_DNA-bdg HTH_10 RP-C Tfb2 EAP30 FeoC B-block_TFIIIC ORC5_C Replic_Relax PCI HTH_17 Rio2_N HTH_41
Other DBs
NCBI-ProteinID: BAK54684
UniProt: F9VNN8
Structure
Position
1898081..1898410
AA seq 109 aa
MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKL
IELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNCAKRMELAAT
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatgaaagaaaaactagagtccaaaaaagatgaaattagatgttgttataaaattaca
gatacagatgtagctgttttactaaagatggtagaaatagagaaacctataacctctgaa
gaattagctgatattttcaagctaagtaagactactgtagaaaatagcttaaagaaattg
atagaactaggtcttgttgttaggactaaaacagaaggaaagaaaattggaagaccaaag
tattactactctatttcatcaaatattctagagaaaataagaaatgacttgcttaactgc
gcaaaaagaatggaattagcagccacctag

DBGET integrated database retrieval system