KEGG   Sulfurisphaera tokodaii: STK_18950
Entry
STK_18950         CDS       T00062                                 
Symbol
gcvH
Name
(GenBank) putative glycine cleavage system H-protein
  KO
K02437  glycine cleavage system H protein
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00785  Lipoic acid metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STK_18950 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_18950 (gcvH)
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    STK_18950 (gcvH)
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N HlyD_D23
Other DBs
NCBI-ProteinID: BAB66989
UniProt: Q96ZD6
Position
1901298..1901744
AA seq 148 aa
MANVSNCEIPENLLYFIEGKNTVWAKQEAPDVIVVGITDIAQTMAGKVVKVRLKKKGTKV
ERGKPVATMESGKWAGPVPAPASGEIIDVNPDVEKNPVLVNQDPYGKGWLVKMKVNNPEE
LKQLVTGSAAVSKLTELINSEKLQCKRL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcaaatgtctcaaattgtgaaattccagaaaatttattatatttcatagaaggtaag
aatactgtatgggcaaaacaagaagccccagatgtcatagtagtaggaataactgatatt
gcacaaacaatggctggtaaggtagttaaggttagattaaagaaaaagggaactaaagtt
gaaaggggtaaaccagtagctacaatggagagcggaaagtgggctggaccagtcccagca
ccagcaagtggagaaattattgatgtaaatccagatgtcgagaaaaacccggttttagtt
aatcaagatccttacggaaagggatggttagtaaagatgaaagttaacaatccagaagag
cttaagcaattggttactggaagcgcagcagtatctaaattaactgaactgattaatagt
gagaaactacagtgcaagaggctatga

DBGET integrated database retrieval system